KEGG   Chlorocebus sabaeus (green monkey): 103235342
Entry
103235342         CDS       T04361                                 

Gene name
NLRP4
Definition
(RefSeq) NLR family pyrin domain containing 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
csab  Chlorocebus sabaeus (green monkey)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csab04131]
    103235342 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:csab04054]
    103235342 (NLRP4)
Membrane trafficking [BR:csab04131]
 Autophagy
  Other autophagy associated proteins
   Others
    103235342 (NLRP4)
Pattern recognition receptors [BR:csab04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   103235342 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 VirE AAA_22 AAA_14
Other DBs
NCBI-GeneID: 103235342
NCBI-ProteinID: XP_007996399
Ensembl: ENSCSAG00000001706
LinkDB
Position
6
AA seq 1057 aa
MNLITFCLHHHAPNTGKILYKKTVILIHLFLIIWHYPEFSTGFIYLLFLVTVSLWIGVSA
LDKMAASFFSDFGLMWYLEELKKEEFRKFKEHLKQMTLHLELKQIPWTEVKKASREELAN
LLIKHYEEQQAWNITLRIFQKMDRKDLCMKVMRERTGYTQTYQTHAKRKFSRLWSSKSVT
EIHLYFQEEVKQEECEHLDHLFAPKETGKQPRTVIIQGPQGIGKTTLLMKLLMAWSDNKI
FRDRFLYTFYFCCRELRELPAMSLADLISREWPDPAAPITEIVSQPERLLFVIDSFEELK
DGLNEPDSALCDDVMEKRPVQVLLSSLLRKKMLPEASLLVAVQPVCPKELRDRVAISEIY
EPRGFNESDRLVYFCCFFKDPKRAMEAFSLVRESEQLFSICQIPLLCWILCTSLKQEMQK
GKDLTLTCQTTTSVYSCFIFNLFTPEGAEGPTPQSQHQLKALCSLAAEGMWTDTFEFRED
DLRRNGVVDTDIPALLGTKVLLKYGERESSYVFLHACIQEFCAALFYLLKSHLDHPHPAV
RSVQELLIANFEKTRRAHWIFLGCFLTGLLNKQEQQKLDAFFGFQLSQEIKQQLHQCLKS
LGEHDDPLGQVDSLAIFYCLFEMQDPAFVKQAVNLLQKADFHIIDNADLVVSAYCLKYCS
SLKKLSFSVQNVFKKEDEHSSMSDYSLVCWHHICSVLTTSGHLRELQVQDSTLSESTFVI
WCNQLRHPSCRLQRLGINNVSFSGPSGQLFEMLFYQPDLKYLSFTLTKLSRDDVRSLCDA
LNSPAGNVKELALVNCFLSPIDCEVLACLLTNNKKLTYLNVSCNDLDAGLPLLCEALCNP
DTVLVYLMLAYCHLSEQCCEYISEMLLHNKSVRYLDLGANVLKDEGLKTLCEALKRPDCR
LDSLCMVKCFITVAGCEDLASALVSNQNLKILEIGCNEIGDVGVKLLCGALTHPNCRLEV
LGLEECGLTSACCKDLASVLTSSKTLQQLNLTLNALDYAGVVVLCEALRHPECALQVLGL
RKTDFDEETQALLMAEEERNPNLTITDDCDTVTRVEI
NT seq 3174 nt   +upstreamnt  +downstreamnt
atgaacctaataactttctgccttcatcaccatgcccccaatactggcaagatactatat
aagaaaacggtaatcttgatccatttatttttaataatttggcactatcctgaattttcc
acaggttttatttatttgttgttcctggtcactgtctctttgtggattggtgtctctgct
ctggacaagatggcggcctctttcttctctgattttggtcttatgtggtatctggaggag
ctcaaaaaggaggagttcaggaaatttaaggaacatctcaagcaaatgactttgcatctt
gaactcaagcagattccctggactgaggtcaaaaaagcatcccgggaagaacttgcaaac
ctcttgatcaagcactatgaagaacaacaggcttggaacataaccttaagaatctttcaa
aagatggatagaaaagatctctgcatgaaggtcatgagggagagaacaggatacacacaa
acctatcaaactcatgcaaagcggaaattcagccgcttatggtccagcaagtctgtcacc
gagattcacctgtacttccaggaggaagtcaagcaagaagaatgtgaacatttggaccac
ctttttgctcccaaggaaactgggaaacagccacgtacggtgatcattcaaggaccgcaa
gggattgggaaaacgacactcctgatgaagctgctgatggcctggtcggacaacaagatc
tttcgggataggttcctgtacacgttctatttctgctgcagagaactgagggagttgccg
gcaatgagcttggctgacctgatttccagagagtggcccgaccccgctgctcctataaca
gagatcgtgtctcagccggagagactgttgtttgtcatcgacagcttcgaagagttgaag
gacggcctgaacgaacccgattcggccctgtgcgacgacgtgatggagaaacggccggtg
caggtgcttctgagcagtttgctgaggaagaagatgctcccggaggcctccctgctcgtg
gccgtccaacccgtgtgcccgaaggagctccgggatcgggtggccatctcagaaatctac
gagccccggggattcaacgagagcgatcggttagtgtatttctgctgtttctttaaagat
ccgaaaagggccatggaagccttcagtcttgtaagagaaagtgaacaactgttttccata
tgccaaatcccgctcctttgctggatcctctgtacctctctgaagcaagagatgcagaaa
ggaaaagacctgaccctgacctgccagaccactacctctgtgtactcctgtttcatcttt
aacctgttcacacccgagggtgccgagggtccgactccgcaaagccagcaccagctgaag
gccctgtgctccctggctgcagagggcatgtggacggacacgtttgagtttcgtgaagac
gacctccggagaaatggggttgttgacactgacatccccgcactgctgggcaccaaggtt
ctcctgaagtacggggagcgtgagagctcctacgtgttcctccacgcgtgtatccaggag
ttctgtgctgccttgttctatttgctcaagagccaccttgatcatcctcacccagctgtg
agaagtgtacaggaattgctaattgccaatttcgaaaaaacaaggagagcacattggatt
tttctaggctgttttctaactggccttttaaataaacaggaacaacagaaactggatgcg
ttttttggcttccaactgtcccaagagataaagcagcaacttcaccagtgcctgaagagc
ttaggggagcatgacgatcctctgggacaggtggattccttggcgatattttactgtctc
ttcgagatgcaggatcctgcctttgtaaagcaggcagtgaacctcctccaaaaagctgac
tttcatattattgacaatgcagacctggtggtttctgcctactgcttaaaatactgctcc
agtttgaagaaactctctttttccgttcaaaatgtctttaagaaagaggatgaacacagc
tctatgtcggattacagccttgtctgttggcatcacatctgctctgtgctcactaccagc
gggcacctcagagagctccaggtacaggacagcaccctcagcgagtcgacctttgtgatc
tggtgtaaccagctgaggcatcccagctgtcgccttcagaggctcggaataaataacgtt
tccttttctggcccgagtggtcagctctttgagatgctcttttatcagccagacttgaaa
tacctgagcttcactctcacgaaactctctcgtgatgacgtcaggtccctctgtgatgcc
ttgaactccccagcgggcaacgtaaaagagctagcgctggtaaattgtttcctctcaccc
atcgattgtgaagtccttgcctgccttctaaccaacaacaagaagctgacgtatctgaat
gtatcctgcaacgacttagacgcaggcttgcctcttctgtgtgaagccctgtgcaaccca
gacacggtgctggtatacctgatgctggcttactgccacctcagtgagcagtgctgtgaa
tacatctctgaaatgcttctgcataacaagagcgtgcgctatctagacctcggcgccaat
gtcctgaaggacgaaggactgaaaaccctctgcgaggccttgaaacgcccagactgccgc
ctggattcgctgtgtatggtaaaatgttttatcactgttgccggctgtgaagacctcgcc
tccgctctcgtcagcaatcaaaacctgaagattctggaaattgggtgcaatgaaatagga
gacgtgggcgtgaagctgttgtgtggggctctgacgcatccgaattgccgcttagaggtt
cttgggttggaagaatgtgggttaacgagtgcctgctgtaaggatctcgcgtctgttctc
accagcagtaagaccctgcagcagctcaacctgaccttgaacgccttggactacgcaggg
gtggttgtgctctgtgaggccctgagacacccagagtgcgccctgcaggtgctcgggctg
agaaaaactgattttgatgaggaaacccaggcacttctgatggctgaggaagagagaaat
cctaacctgaccatcacagacgactgtgacacagttacaagggtagaaatctga

DBGET integrated database retrieval system