KEGG   Chlorocebus sabaeus (green monkey): 103236209
Entry
103236209         CDS       T04361                                 

Gene name
IL2
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04060  Cytokine-cytokine receptor interaction
csab04061  Viral protein interaction with cytokine and cytokine receptor
csab04151  PI3K-Akt signaling pathway
csab04625  C-type lectin receptor signaling pathway
csab04630  Jak-STAT signaling pathway
csab04658  Th1 and Th2 cell differentiation
csab04659  Th17 cell differentiation
csab04660  T cell receptor signaling pathway
csab04672  Intestinal immune network for IgA production
csab04940  Type I diabetes mellitus
csab05135  Yersinia infection
csab05142  Chagas disease (American trypanosomiasis)
csab05162  Measles
csab05166  Human T-cell leukemia virus 1 infection
csab05200  Pathways in cancer
csab05320  Autoimmune thyroid disease
csab05321  Inflammatory bowel disease (IBD)
csab05330  Allograft rejection
csab05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    103236209 (IL2)
   04151 PI3K-Akt signaling pathway
    103236209 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103236209 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103236209 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103236209 (IL2)
   04660 T cell receptor signaling pathway
    103236209 (IL2)
   04658 Th1 and Th2 cell differentiation
    103236209 (IL2)
   04659 Th17 cell differentiation
    103236209 (IL2)
   04672 Intestinal immune network for IgA production
    103236209 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103236209 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103236209 (IL2)
   05321 Inflammatory bowel disease (IBD)
    103236209 (IL2)
   05330 Allograft rejection
    103236209 (IL2)
   05332 Graft-versus-host disease
    103236209 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103236209 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103236209 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103236209 (IL2)
   05162 Measles
    103236209 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    103236209 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csab04052]
    103236209 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:csab00536]
    103236209 (IL2)
Cytokines and growth factors [BR:csab04052]
 Cytokines
  Interleukins
   103236209 (IL2)
Glycosaminoglycan binding proteins [BR:csab00536]
 Heparan sulfate / Haparin
  Cytokines
   103236209 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 103236209
NCBI-ProteinID: XP_007997918
Ensembl: ENSCSAG00000003667
UniProt: A0A0D9QUJ6
LinkDB
Position
7
AA seq 154 aa
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRDTKDLISNINVIVLELKGS
ETTLMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agagataccaaggacttaatcagcaatatcaacgtaatagttctggaactaaagggatct
gaaacaacactgatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaac
agatggattaccttttgtcaaagcatcatctcaacactgacctga

DBGET integrated database retrieval system