KEGG   Chlorocebus sabaeus (green monkey): 103236284Help
Entry
103236284         CDS       T04361                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00480  Glutathione metabolism
csab00980  Metabolism of xenobiotics by cytochrome P450
csab00982  Drug metabolism - cytochrome P450
csab00983  Drug metabolism - other enzymes
csab01524  Platinum drug resistance
csab05200  Pathways in cancer
csab05204  Chemical carcinogenesis
csab05225  Hepatocellular carcinoma
csab05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:csab00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103236284 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103236284 (MGST2)
   00982 Drug metabolism - cytochrome P450
    103236284 (MGST2)
   00983 Drug metabolism - other enzymes
    103236284 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    103236284 (MGST2)
   05204 Chemical carcinogenesis
    103236284 (MGST2)
   05225 Hepatocellular carcinoma
    103236284 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    103236284 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    103236284 (MGST2)
Enzymes [BR:csab01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103236284 (MGST2)
Transporters [BR:csab02000]
 Other Transporters
  Pores ion channels [TC:1]
   103236284 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 103236284
NCBI-ProteinID: XP_007998027
Ensembl: ENSCSAG00000003527
UniProt: A0A0D9S0Y4
LinkDB All DBs
Position
7
AA seq 147 aa AA seqDB search
MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLMYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTL
LGALGIANSFLDEYLDLNIAKKLRRQF
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaactcgatcctgctggctgctgtctctattctctcggcctgtcagcaaagt
tattttgctttgcaagttggaaaggcaagattaaaatacaaagttacacccccagcagtc
actgggtcaccagagtttgagagagtatttcgggcacaacaaaactgtgtggagttttat
cctatattcataattacattgtggatggctgggtggtatttcaaccaagtttttgctact
tgtctgggtctgatgtacatatatggccgtcacctatacttctggggatattcagaagct
gctaaaaaacggatcactggtttccgactgagtctggggattttggccttgttgaccctc
ctaggtgccctgggaattgcaaacagctttctggatgaatatctggacctcaatattgcc
aagaaactgaggcggcaattctaa

DBGET integrated database retrieval system