KEGG   Chlorocebus sabaeus (green monkey): 103237714Help
Entry
103237714         CDS       T04361                                 

Definition
(RefSeq) lymphocyte-specific protein 1
  KO
K14957  lymphocyte-specific protein 1
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04625  C-type lectin receptor signaling pathway
csab05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:csab00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103237714
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103237714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caldesmon
Motif
Other DBs
NCBI-GeneID: 103237714
NCBI-ProteinID: XP_008000264
Ensembl: ENSCSAG00000009863
UniProt: A0A0D9RBW6
LinkDB All DBs
Position
1
AA seq 339 aa AA seqDB search
MAEASSDPGAEEREELLGPTAQWSVEDEEEATRNPCRQERDRQLQAQDVDGGGHVPERPE
HEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQEHEGVQGASDSREPPRCRSPEGEQEDKP
GLHAGEKEDGDEVHLEELSLSKEEPDPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLI
LEGTIEHSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQRLEQYTQAIET
AGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSATKTPSCKDIVAGDMSKKSLWEQK
GGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcttcgagtgacccaggcgccgaggagcgggaagagttgctggggcccact
gctcagtggagtgtggaagacgaggaggaggccacccgcaacccatgccggcaggagaga
gaccggcagcttcaggcccaggatgtggacggaggcggccatgtccccgagcggccggag
cacgagatgctcctcagcctgaagccctcggaggcccctgaactggatgaggacgagggc
tttggcgactggtcccagaggccagagcagcgacaggagcatgagggggtccagggagcc
tcggacagcagagaacccccccggtgcaggagtcctgagggggagcaagaggacaagccc
ggcctgcatgctggtgaaaaggaggacggtgacgaagtccacctggaggagttgagtctg
agcaaggaggagccagacccagaggacactgtccaggacaacctgggggccgcaggggct
gaggaggagcaggaggagcaccagaaatgtcagcagcccaggacacccagccccttgatc
ttggaggggaccattgaacacagctcacctcccctgagccccaccactaaactcatcgac
aggaccgagtccctaaaccgctccatagagaagagtaacagtgtgaagaagtcccaacca
gacttgcccatctccaagattgaccagcggctggaacaatacacccaggccatcgagacc
gctggccggacccccaagctagcccgccaggcctccatagagctgcccagcatggccgtg
gccagtaccaagagtcggtgggagacgggtgaggtacaggctcagtctgccaccaagact
ccatcctgcaaggatattgtggctggagacatgagcaagaaaagcctctgggagcagaag
ggaggctccaagacctcatcaacaattaagagcaccccatctgggaagaggtataagttt
gtggccaccgggcatgggaagtatgagaaggtgcttgtggaagggggcccggcgccctag

DBGET integrated database retrieval system