KEGG   Chlorocebus sabaeus (green monkey): 103238027Help
Entry
103238027         CDS       T04361                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00250  Alanine, aspartate and glutamate metabolism
csab00410  beta-Alanine metabolism
csab00430  Taurine and hypotaurine metabolism
csab00650  Butanoate metabolism
csab01100  Metabolic pathways
csab04727  GABAergic synapse
csab04940  Type I diabetes mellitus
Module
csab_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103238027 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103238027 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103238027 (GAD2)
   00430 Taurine and hypotaurine metabolism
    103238027 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    103238027 (GAD2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    103238027 (GAD2)
Enzymes [BR:csab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103238027 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 103238027
NCBI-ProteinID: XP_008000767
Ensembl: ENSCSAG00000012130
UniProt: A0A0D9RI75
LinkDB All DBs
Position
9
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSENGSGDSDNPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SQPPRVTARKAACACDQKPCSCPKADVNYGFLHATDLLPACDGERPTLAFLQDVMNILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMMIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQNCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYIPPSLRTLEDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccgggctctggcttttggtccttcgggtcggaaaatggctccggggattcc
gacaatcccggcacagcgcgagcctggtgccaagtggctcagaagttcactggcggcatc
ggaaacaaactgtgcgccctgctctacggagacgccgagaagccggcggagagcggcggg
agccaacccccgcgggtcaccgcccggaaggccgcctgcgcctgcgaccagaagccctgc
agctgccccaaagcggatgtcaactacgggtttctccacgcaacagacctgctgccggcg
tgtgatggagaaaggccaactttggcgtttctgcaagatgttatgaacattttacttcag
tatgtggtgaaaagtttcgatagatcaaccaaagtgattgatttccattatcctaatgag
cttctccaagaatataattgggaattggcagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacagggcatcctagatacttcaat
caactttccactggattggatatggttggattagcagcagactggctgacatcaacagca
aatactaacatgttcacctatgaaattgctccagtatttgtgcttttggaatatgtcaca
ctaaagaaaatgagagaaatcattggctggccagggggctccggcgatgggatattttct
cccggtggcgccatatctaacatgtatgccatgatgatcgcgcgctttaagatgttcccg
gaagtcaaggagaaaggaatggctgctgttcccaggctcattgccttcacgtctgagcat
agtcatttttctctcaagaagggagctgcagccttagggattggaacagacagcgtgatt
ctgattaaatgtgatgagagagggaaaatgatcccatctgatcttgaaagaaggatcctc
gaagccaaacagaaaggatttgttcctttcctcgtgagtgccacagctggaactaccgtg
tatggagcatttgatccgctcttagctgtcgctgacatttgcaaaaagtataagatctgg
atgcacgtggatgcagcttggggtggaggattactgatgtcccgaaaacacaagtggaaa
ctgagtggcgtggagagggccaactctgtgacgtggaatccacacaagatgatgggagtc
cctttgcagtgctctgctctcctggttagagaagagggattgatgcagaattgcaaccaa
atgcatgcctcctacctctttcagcaagataaacattatgacctgtcctatgacactggc
gataaggccttacagtgtggacgccacgttgatgtttttaaactatggctgatgtggagg
gcaaaggggactaccgggtttgaagcacatgttgataaatgtttggagttggcagagtat
ttatacaacatcataaaaaaccgagaaggatatgagatggtgtttgacgggaagcctcag
cacacaaatgtctgcttctggtacattcctccaagcttgcgtactctggaagacaatgaa
gagagaatgagtcgcctctcaaaggtggctccagtgattaaggccagaatgatggagtat
ggaacaacaatggtcagctaccaacccttgggagacaaggtcaatttcttccgcatggtc
atctcaaatcccgcagcaactcaccaagacattgacttcctgattgaagaaatagaacgt
cttggacaagatttataa

DBGET integrated database retrieval system