KEGG   Chlorocebus sabaeus (green monkey): 103238217Help
Entry
103238217         CDS       T04361                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00010  Glycolysis / Gluconeogenesis
csab00030  Pentose phosphate pathway
csab00051  Fructose and mannose metabolism
csab00052  Galactose metabolism
csab01100  Metabolic pathways
csab01200  Carbon metabolism
csab01230  Biosynthesis of amino acids
csab03018  RNA degradation
csab04152  AMPK signaling pathway
csab05230  Central carbon metabolism in cancer
Module
csab_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103238217 (PFKM)
   00030 Pentose phosphate pathway
    103238217 (PFKM)
   00051 Fructose and mannose metabolism
    103238217 (PFKM)
   00052 Galactose metabolism
    103238217 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103238217 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103238217 (PFKM)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    103238217 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csab01009]
    103238217 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:csab03019]
    103238217 (PFKM)
Enzymes [BR:csab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103238217 (PFKM)
Protein phosphatases and associated proteins [BR:csab01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103238217 (PFKM)
Messenger RNA biogenesis [BR:csab03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103238217 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 103238217
NCBI-ProteinID: XP_008001220
Ensembl: ENSCSAG00000006315
LinkDB All DBs
Position
11
AA seq 879 aa AA seqDB search
MGPAVTAGRRPLRRPGERDQKERPQEGAMHKDEFHLKFFMCVIQSRQLVRTPQRTAGEAS
TSSMLIPKPQTKTDTLKNLDTLDDPDTVRSIPVFKTEWIMTHEEHHAAKTLGIGKAIAVL
TSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDNIKEATWESVSMMLQLGG
TVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLGDLQK
AGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIIEIVDAITTTAQSHQR
TFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIII
VAEGAIDRNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQRGGTPSAFDRILGSRMGVEAV
MALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMEEKKFDEALKLRGRSFMNN
WEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFE
GLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISANITKFNIQGLVIIGGFEA
YTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICTTCDRIKQSAA
GTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRDLQANVEHLVQKMKTTVK
RGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGA
KAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALLFQPVTELQGQTDFEHRIPKEQW
WLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEGAV
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggggcctgctgtaacggcagggagacggcctctccgccgcccaggagagagagaccag
aaggaacggcctcaggagggagccatgcataaagacgagtttcatctgaaatttttcatg
tgtgtgattcaatctcgccagttagtcaggactcctcagagaacagctggggaagcttct
acttccagcatgctcataccaaagccacaaacaaagacagacaccttgaagaatctagat
actttggatgatccagacaccgtgagaagcatacctgttttcaaaactgagtggatcatg
acccatgaagagcaccatgcagccaaaaccctggggattggcaaagccatcgccgtctta
acctctggcggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagttggt
attttcaccggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtggatggt
ggagataacatcaaggaagccacctgggagagcgtttcaatgatgcttcagctgggaggc
acggtgattggaagtgcccggtgcaaggactttcgggaacgagaaggacgactccgagct
gcctacaacctggtgaagcgtgggatcaccaatctctgtgtcattgggggtgatggcagc
ctcactggggctgacaccttccgttctgagtggagtgacttgttgggtgacctccagaaa
gcaggtaagatcacagatgaggaggctacgaagtccagctacctgaacattgtgggcctg
gttgggtcaattgacaatgacttctgtggcaccgatatgaccattggcactgactctgcc
ctccaccggatcatagaaattgtagatgccatcactaccactgcccagagccaccagagg
acatttgtgttagaagtgatgggccgccactgtggatacctggcccttgtcacctctctg
tcctgtggggccgactgggtttttattcctgaatgtccaccagatgacgactgggaggag
cacctttgtcgccgactcagcgagacaaggactcgtggttctcgtctcaacatcatcatt
gtggctgagggtgcaattgacaggaatggaaaaccaatcacctcagaagacatcaagaat
ctggtggtaaagcgtctgggatatgacacccgggttactgtcttggggcatgtgcagagg
ggtgggacgccatcggcctttgacagaattctgggcagcagaatgggtgtggaagcagtg
atggcacttctggaggggaccccagataccccagcctgtgtagtgagcctctctggtaac
caggctgtgcgcctgcccctcatggaatgtgtccaggtgaccaaagatgtgaccaaggcc
atggaagagaagaaatttgatgaagccctgaagttgagaggccggagcttcatgaacaac
tgggaggtatacaagcttctagctcatgtcagacccccggtatctaagagtggttcgcac
acagtggctgtgatgaatgtgggggctccggctgcaggcatgaatgctgctgttcgctcc
actgtgaggattggacttatccagggcaaccgagtgctcgttgtccatgatggtttcgag
ggcctggccaaggggcagatagaggaagctggctggagctatgttgggggctggactggc
caaggtggctctaaacttgggactaaaaggactctacccaagaagagctttgaacagatc
agtgccaatataactaagtttaacattcagggacttgtcatcattgggggctttgaggct
tacacaggtggcctggaactgatggagggcaggaagcagtttgatgagctctgcatccca
tttgtggtcattcctgctacagtctccaacaacgtccctggctcagacttcagcgttggg
gctgacacagcactcaatactatctgcacgacctgtgaccgcatcaagcagtcagcagct
ggcaccaagcgtcgggtgtttatcattgagactatgggtggctactgtggctacctggcc
accatggctggactggcagctggggccgatgctgcctacatttttgaggagcccttcacc
attcgagacctgcaggcaaatgttgaacacctggtgcaaaagatgaaaacaactgtgaaa
aggggcttggtgttaaggaatgaaaagtgcaatgagaactataccactgacttcattttc
aacctgtactctgaggaggggaagggcatcttcgacagcaggaagaatgtgcttggtcac
atgcagcagggtgggagcccaaccccatttgataggaattttgccactaagatgggtgcc
aaggctatgaactggatgtctgggaaaatcaaagagagttaccgtaatgggcggatcttc
gccaatactccagactcgggctgtgttctggggatgcgtaagagggctctgcttttccaa
ccagtgactgagctgcagggccagacagattttgagcatcgaatccccaaggaacagtgg
tggctgaaactgaggcccatcctcaaaatcctagccaagtacgagattgacttggacact
tcagaccatgcccacctggagcacatcacccggaagcggtctggggaaggggctgtttaa

DBGET integrated database retrieval system