KEGG   Chlorocebus sabaeus (green monkey): 103239440Help
Entry
103239440         CDS       T04361                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00512  Mucin type O-glycan biosynthesis
csab01100  Metabolic pathways
Module
csab_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103239440 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csab01003]
    103239440 (GALNT9)
Enzymes [BR:csab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103239440 (GALNT9)
Glycosyltransferases [BR:csab01003]
 O-Glycan biosynthesis
  Mucin-type
   103239440 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 103239440
NCBI-ProteinID: XP_008003474
Ensembl: ENSCSAG00000001863
UniProt: A0A0D9S5M9
LinkDB All DBs
Position
11
AA seq 603 aa AA seqDB search
MAVARKIRTLLTVNILVFVGIVLFSVYCRLQGRSQELVRIVSGDRRVRSRHAKVGALGDR
EAILQRLDHLEEVVYNQLNGLAKPIGLVEGPGGLGQGGLAATLRDDGQEAEGKYEEYGYN
AQLSDRISLDRSIPDYRPRKCRHMSYAQDLPQVSVVFIFVNEALSVILRSVHSVVNHTPS
QLLKEVILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNSRREGLIRARLQGWKAATAPV
VGFFDAHVEFNTGWAEPALSRIREDRRRIVLPAIDNIKYSTFEVQQYANAAHGYNWGLWC
MYIIPPQDWLDRGDESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENVELGMRV
WQCGGSMEVLPCSRVAHIERTRKPYNKDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIPM
TNPGVDFGDVSERLALRQRLKCRSFKWYLENVYPEMRIYNNTLTYGEVRNSKASGYCLDQ
GAEDGDRAILYPCHGMSSQLVRYSADGLLQLGPLGSTAFLPDSKCLVDDGRGRTPTLRKC
EDVARPTQRLWDFTQSGPIVSRATGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIKH
ARH
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccaggaagatccgaactttgctgacggtgaacatcctggtgttcgtgggc
atcgtcctgttctccgtgtactgccgcctgcagggccgctcccaggagctcgtgcgcatc
gtgagcggcgaccgccgggtgcgcagccgacacgccaaggtgggcgcgctgggggaccgc
gaggccatcctgcagcgcctggaccacctggaggaggtggtctacaaccagctcaacggc
ctcgccaagcccatcggcctggtggaggggccaggaggcctgggccagggtggcttggcg
gccaccctgcgtgatgatggccaggaggcggaaggcaagtatgaggagtacggctacaac
gctcagctcagcgaccgcatctccctggatcggagcatccccgactaccggcccagaaag
tgcagacacatgagctatgcccaggacctgccccaggtctccgtggtcttcatctttgtc
aacgaggcgctgtcggtcatcctgcgctccgtgcacagcgtggtcaaccacacgccctcc
cagctcctcaaggaggtcatcctggtggacgacaacagtgacaatgtggagctcaagttc
aatctggaccagtatgtcaacaagcggtacccgggcctcgtgaagatcgtccgcaatagc
cggcgggaaggactgatccgcgcccggctgcagggctggaaggcggccactgccccagtt
gtcggcttcttcgatgcccacgtcgagttcaacacgggctgggcagagcccgcactgtct
cggatccgagaggaccggcgtcgcatcgtgctgccagccatagacaacatcaagtacagc
acgtttgaggtgcagcagtacgccaacgctgcccacggctacaactggggcctctggtgc
atgtacatcatccccccgcaggactggctggaccgcggcgacgagtcggcacccatcagg
accccggccatgatcggctgctccttcgtggtggaccgcgagtacttcggagacatcggg
ctgctagaccctggcatggaggtgtacggtggcgagaacgtagaactgggcatgagggtg
tggcagtgtggtggcagcatggaggtgctgccctgctcccgcgtggcccacatcgagcgc
accaggaagccctacaacaaggacatcgactactatgccaagcgcaacgccctgcgcgcc
gccgaggtgtggatggacgacttcaagtcccacgtgtacatggcctggaacatccccatg
acgaacccaggggtggacttcggggacgtgtctgagaggctggccctgcgccagaggctg
aagtgccgcagcttcaagtggtacttggagaacgtgtacccagagatgaggatctacaac
aacaccctcacgtacggagaggtgagaaatagcaaagccagcggctactgcctggaccag
ggagcggaggacggcgaccgggcgatcctctacccctgccacgggatgtcctcccagctg
gtgcggtacagcgcggacggcctgctgcagctggggcctctgggctccacagccttcttg
cccgactccaagtgtctggtggatgacggcaggggccgcacgcccaccctgaggaagtgt
gaggatgtggcgaggcccacacagcggctgtgggacttcacccagagcggccccattgtg
agccgggccacgggccgctgcctggaggtggagatgtccaaagatgccaacttcgggctc
cggctggtggtgcagaggtgctcggggcagaagtggatgatcagaaactggatcaaacac
gcacggcactga

DBGET integrated database retrieval system