KEGG   Chlorocebus sabaeus (green monkey): 103240535Help
Entry
103240535         CDS       T04361                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04110  Cell cycle
csab04213  Longevity regulating pathway - multiple species
csab04330  Notch signaling pathway
csab04919  Thyroid hormone signaling pathway
csab05016  Huntington's disease
csab05034  Alcoholism
csab05165  Human papillomavirus infection
csab05169  Epstein-Barr virus infection
csab05200  Pathways in cancer
csab05202  Transcriptional misregulation in cancer
csab05203  Viral carcinogenesis
csab05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:csab00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    103240535 (HDAC2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    103240535 (HDAC2)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    103240535 (HDAC2)
  Aging
   04213 Longevity regulating pathway - multiple species
    103240535 (HDAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    103240535 (HDAC2)
   05202 Transcriptional misregulation in cancers
    103240535 (HDAC2)
   05203 Viral carcinogenesis
    103240535 (HDAC2)
   05220 Chronic myeloid leukemia
    103240535 (HDAC2)
  Neurodegenerative diseases
   05016 Huntington's disease
    103240535 (HDAC2)
  Substance dependence
   05034 Alcoholism
    103240535 (HDAC2)
  Infectious diseases
   05169 Epstein-Barr virus infection
    103240535 (HDAC2)
   05165 Human papillomavirus infection
    103240535 (HDAC2)
Enzymes [BR:csab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103240535 (HDAC2)
Chromosome and associated proteins [BR:csab03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     103240535 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     103240535 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    103240535 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    103240535 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103240535
NCBI-ProteinID: XP_008005472
LinkDB All DBs
Position
13
AA seq 731 aa AA seqDB search
MNKRQTRKLGYQALGRWTAARRGRGPGRGAGVGSPRRAPGTWSARAGASRQWGRGAAWDA
DKGSRPPRLRGADCAGSGTGATTARRPEGGERSPGCTLPRSTCAAKACLLPHFKTVYGAA
LRRLFTLRGPLISSPKRPPSPAVPLPPPRRPQWARPPPCGLRRWFGGPLLSSVASWCRCH
PRFRSFGTSAFPAPPPLLPPTCPSPRDYRPHVSLSPFLSRPSRGGSSSSSRRRSPEAAVA
GESMAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRP
HKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGG
SVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDID
IHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDES
YGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLL
MLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTP
EYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIAC
DEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKADVKEEDKSKDNSGEKTDT
KGTKSEQLSNP
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgacaaacgagaaaactaggctaccaggcactggggcgatggaccgcagcc
cggcgcggtcgtgggccgggaaggggcgcaggagtgggctctccccgccgggctcccggc
acgtggtcggctcgggcgggagcttcgcggcagtgggggaggggagcagcgtgggacgcc
gacaaggggtccagaccgccaaggctacgaggcgccgactgcgcaggctcggggacaggc
gcaaccactgcgcgcagacctgaggggggcgaacgttcacccggctgcacgctccctaga
tctacttgcgcagcgaaagcttgtctacttcctcattttaagactgtgtatggcgccgcc
ttgcgcaggttgttcaccctcagagggcctctaatctcgagcccgaagcggcctccttct
ccagccgtgccccttcctcccccgcggaggccgcagtgggcgcgcccacctccctgcggc
ctccggaggtggtttggtggccccctcctctccagtgtcgctagttggtgccgctgccac
ccccggttccgatctttcggcacctcagccttcccggcgccccctcctctcctcccaccg
acctgcccttccccgcgggactaccgcccccacgtttcccttagcccttttctgtcccgg
ccgagccgcggcggcagcagcagcagcagcaggaggaggagcccggaggcggcggtggcc
ggggagtccatggcgtacagtcaaggaggcggcaaaaaaaaagtctgctactactacgac
ggtgatattggaaattattattatggacagggtcatcccatgaagcctcatagaatccgc
atgacccataacttgttgttaaattatggcttatacagaaaaatggaaatatataggccc
cataaagccactgctgaagaaatgacaaaatatcacagtgatgagtatatcaaatttctg
cggtcaataagaccagataacatgtctgagtatagtaagcagatgcagagatttaatgtt
ggagaagattgtccagtgtttgatggactctttgagttttgtcaactctcaactggtggt
tcagttgctggagccgtgaagttaaaccgacaacagactgatatggctgttaattgggct
ggaggattacatcatgctaagaaatcagaagcatcaggattctgttatgttaatgatatt
gtgcttgccatccttgaattactaaagtatcatcagagagtcttatatattgacatagat
attcatcatggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgacggta
tcattccataaatatggggaatactttcctggcacaggagacttgagggatattggtgct
ggaaaaggcaaatactatgctgtcaattttccaatgagagatggtatagatgatgagtca
tatgggcagatatttaagcctattatctcaaaggtgatggagatgtatcaacctagtgct
gtggtattacagtgtggtgcagactcattatctggtgatagactgggttgtttcaatcta
acagtgaaaggtcatgctaaatgtgtagaagttgtaaaaacttttaacttaccattactg
atgcttggtggaggtggatacacaatccgtaatgttgctcgatgttggacatatgagact
gcagttgcccttgattgtgagattcccaatgagttgccgtataatgattactttgagtat
tttggaccagacttcaaactgcatattagtccttcaaacatgacaaaccagaacactcca
gaatatatggaaaagataaaacagcgtttatttgaaaatttgcgcatgttacctcatgca
cctggtgtccagatgcaagctattccagaagatgctgttcatgaagacagtggagatgaa
gatggagaagatccagacaagagaatttctattcgagcgtcagacaagcggatagcttgt
gatgaagaattctcagattctgaggatgaaggagaaggaggtcgaagaaatgtggctgat
cataaaaaaggagcaaagaaagctagaattgaagaagataagaaagaaacagaggacaaa
aaagcagacgttaaggaagaagataaatccaaggacaacagtggtgaaaaaacagatacc
aaaggaaccaaatcagaacagctcagcaacccctga

DBGET integrated database retrieval system