KEGG   Chlorocebus sabaeus (green monkey): 103241808
Entry
103241808         CDS       T04361                                 

Gene name
TGFBR2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04010  MAPK signaling pathway
csab04060  Cytokine-cytokine receptor interaction
csab04068  FoxO signaling pathway
csab04144  Endocytosis
csab04218  Cellular senescence
csab04350  TGF-beta signaling pathway
csab04380  Osteoclast differentiation
csab04390  Hippo signaling pathway
csab04520  Adherens junction
csab04659  Th17 cell differentiation
csab04926  Relaxin signaling pathway
csab04933  AGE-RAGE signaling pathway in diabetic complications
csab05142  Chagas disease
csab05161  Hepatitis B
csab05166  Human T-cell leukemia virus 1 infection
csab05200  Pathways in cancer
csab05202  Transcriptional misregulation in cancer
csab05210  Colorectal cancer
csab05212  Pancreatic cancer
csab05220  Chronic myeloid leukemia
csab05225  Hepatocellular carcinoma
csab05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103241808 (TGFBR2)
   04350 TGF-beta signaling pathway
    103241808 (TGFBR2)
   04390 Hippo signaling pathway
    103241808 (TGFBR2)
   04068 FoxO signaling pathway
    103241808 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103241808 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103241808 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    103241808 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103241808 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103241808 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103241808 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103241808 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103241808 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    103241808 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103241808 (TGFBR2)
   05212 Pancreatic cancer
    103241808 (TGFBR2)
   05225 Hepatocellular carcinoma
    103241808 (TGFBR2)
   05226 Gastric cancer
    103241808 (TGFBR2)
   05220 Chronic myeloid leukemia
    103241808 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103241808 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103241808 (TGFBR2)
   05161 Hepatitis B
    103241808 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103241808 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csab01001]
    103241808 (TGFBR2)
Enzymes [BR:csab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103241808 (TGFBR2)
Protein kinases [BR:csab01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103241808 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal Trm112p APH
Other DBs
NCBI-GeneID: 103241808
NCBI-ProteinID: XP_008007542
Ensembl: ENSCSAG00000009648
LinkDB
Position
15
AA seq 592 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEVEAQKGEMICPSCNRTAYPLRHINND
MMVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCLSNCSITSICEKPQEVCVAVWRKNDENI
TLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNT
SNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRVNRQQKLSSSWEAGKPRKLMDFSEH
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCE
TLTECWDHDPEARLTAQCVAERFSELEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggatgtggaagtggaggcccagaaaggt
gaaatgatctgccccagctgtaataggactgcctatccactgagacatattaacaatgac
atgatggtcactgacaacaatggtgcagtcaagtttccacaactgtgtaaattttgtgat
gtgagattttccacctgtgacaaccagaaatcctgcctgagcaactgcagcatcacctcc
atctgtgaaaagccacaggaagtctgtgtggctgtatggagaaagaatgacgagaacata
acactagagacagtttgccatgatcccaagctcccctaccatgactttattctggaagat
gctgcttctccaaagtgcattatgaaggaaaaaaaaaagcctggtgagactttcttcatg
tgttcctgtagctctgatgagtgcaatgacaacatcatcttctcagaagaatacaacacc
agcaatcctgacttgttgctagtcatatttcaagtgacaggcatcagcctcctgccacca
ctgggcgttgccatatctgtcatcatcatcttctactgctaccgcgttaaccggcagcag
aagctgagttcatcctgggaagctggcaagccacggaagctcatggacttcagcgagcac
tgtgccatcatcctggaagacgaccgctctgacatcagctccacatgcgccaacaacatc
aaccacaacacagagctgctgcccattgaactggacaccctggtggggaaaggtcgcttt
gctgaggtctataaggccaagctgaagcagaacacttcagagcagtttgagacagtggca
gtcaagatctttccctatgaggagtatgcctcttggaagacggagaaggacatcttctca
gacatcaacctgaagcatgagaacatactccagttcctgacagctgaggagcgcaagacg
gagttagggaaacagtactggctgatcactgccttccatgccaagggcaacctacaggag
tacctgacgcggcatgtcatcagctgggaggacctgcgcaaactgggcagctccctcgcc
cggggcattgctcacctccacagtgatcacactccctgcgggaggcccaagatgcccatc
gtgcacagggacctcaagagctccaatatcctcgtgaagaacgacctgacctgctgcctg
tgtgactttgggctttccctgcgtctggaccctaccctgtctgtggatgacctggctaac
agcgggcaggtgggaactgcaagatacatggctccagaagtcctagaatccaggatgaat
ttggagaatgtagagtccttcaagcagaccgatgtctactccatggctctggtgctctgg
gaaatgacatcccgctgtaatgcagtgggagaagtgaaagattatgagcctccatttggt
tccaaggtgcgggagcacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcga
ggacgaccagaaattcccagcttctggctcaaccaccagggcatccagatggtgtgtgag
acgttgactgagtgctgggaccacgaccccgaggcccgcctcacagcccagtgtgtggca
gaacgcttcagtgagctggagcacctggacaggctctcggggaggagctgctccgaggag
aagattcctgaagacggctccctaaacactaccaaatag

DBGET integrated database retrieval system