KEGG   Chlorocebus sabaeus (green monkey): 103243225Help
Entry
103243225         CDS       T04361                                 

Gene name
MAP3K3
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04010  MAPK signaling pathway
csab04722  Neurotrophin signaling pathway
csab04912  GnRH signaling pathway
csab05166  Human T-cell leukemia virus 1 infection
csab05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103243225 (MAP3K3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103243225 (MAP3K3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103243225 (MAP3K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103243225 (MAP3K3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103243225 (MAP3K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csab01001]
    103243225 (MAP3K3)
Enzymes [BR:csab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103243225 (MAP3K3)
Protein kinases [BR:csab01001]
 Serine/threonine kinases: STE group
  STE11 family
   103243225 (MAP3K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 103243225
NCBI-ProteinID: XP_008010347
Ensembl: ENSCSAG00000003874
UniProt: A0A0D9QV48
LinkDB All DBs
Position
16
AA seq 657 aa AA seqDB search
MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQKKHNSSSSALLNSPTVTT
SSCAGASEKKKFLSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQPLDLHYMNNE
LSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQDRNHNSSSPHSGVSRQVRIKASQSAG
DINTIYQPPEPRSRHLSVSSQNPGRSSPPPGYVPERQQHIARQGSYTSINSEGEFIPETS
EQCMLDPLSSAENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEYSDRETQLYDKG
VKGGTYPRRYHVSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYL
DPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELA
SKQVQFDPDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGG
SVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFG
ASKRLQTICMSGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE
YEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHFAQLMY
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacaggaggcattgaactcaatcatgaacgatctggtggccctccagatgaac
cgacgtcaccggatgcctggatatgagaccatgaagaacaaagacacaggtcactcaaat
aggcagaaaaaacacaacagcagcagctcagcccttctgaacagccccacagtaacaaca
agctcatgtgcaggggccagtgagaaaaagaaatttttgagtgacgtcagaatcaagttt
gagcacaatggggagaggcgaattatagcattcagccggcctgtgaaatatgaagatgtg
gagcacaaggtgacaacagtatttggacaacctcttgatctacattacatgaacaatgag
ctctccatcctgctgaaaaaccaagatgatcttgataaagcaattgacattttggataga
agctcaagcatgaaaagccttaggatattgctgttgtcccaggacagaaaccataacagt
tcctctccccactctggggtgtctagacaggtgcggatcaaggcttcccagtctgcaggg
gatataaatactatctaccagccccccgagcccagaagcaggcacctctccgtcagctcc
cagaaccctggccgaagctcacctccccctggctatgttcctgagcggcagcagcacatt
gcccggcaggggtcctacaccagcatcaacagtgagggggagttcatcccagagaccagc
gagcagtgcatgctggatcccctgagcagtgcagaaaattccttgtctggaagctgccag
tccttggacaggtcagcagacagcccatccttccggaaatcacgaatgtcccgtgcccag
agcttccctgacaatagacaggaatactcagatcgggaaactcagctctatgacaaaggg
gtcaaaggtggaacctacccccgccgctaccatgtgtctgtgcaccacaaggactacagt
gatggcagaagaacatttccccgaatacggcgtcatcaaggcaacttgttcaccctggtg
ccctccagccgctccctgagcacaaatggcgagaacatgggtctggctgtgcaatacctg
gacccccgtgggcgcctgcggagtgcagacagcgagaatgccctctctgtgcaggagagg
aatgtgccaaccaagtctcccagtgcccccatcaattggcgccggggaaagctcctgggc
cagggtgccttcggcagggtctatttgtgctatgacgtggacacgggacgtgaacttgct
tccaagcaggtccagtttgacccagacagtcctgagacaagcaaggaggtgagtgctctg
gagtgcgagatccagttgctaaagaacttgcagcatgagcgcatcgtgcagtactatggc
tgtctgcgggaccgtgctgagaagaccctgaccatcttcatggagtacatgccagggggc
tcggtgaaagaccagttgaaggcttatggtgctctgacagagagcgtgacccgaaagtac
acgcggcagatcctggagggcatgtcctacctgcacagcaacatgatcgttcaccgggac
attaagggagccaacatcctccgagactctgctgggaatgtaaagctgggggactttggg
gccagcaaacgcctgcagacgatctgtatgtcggggacaggcatgcgctccgtcactggc
acaccctactggatgagccctgaggtgatcagcggcgagggctatggaaggaaagcagac
gtgtggagcctgggctgcactgtggtggagatgctgacagagaaaccaccatgggcagag
tatgaagctatggccgccatcttcaagattgccacccagcccaccaatcctcagctgccc
tcccacatctctgaacatggccgggacttcctgaggcgcatttttgtggaggctcgccag
agaccttcagctgaggagctgctcacacaccactttgcacagctcatgtactga

DBGET integrated database retrieval system