KEGG   Chlorocebus sabaeus (green monkey): 103243690Help
Entry
103243690         CDS       T04361                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00052  Galactose metabolism
csab00500  Starch and sucrose metabolism
csab01100  Metabolic pathways
csab04142  Lysosome
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103243690 (GAA)
   00500 Starch and sucrose metabolism
    103243690 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103243690 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csab04147]
    103243690 (GAA)
Enzymes [BR:csab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103243690 (GAA)
Exosome [BR:csab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103243690 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103243690
NCBI-ProteinID: XP_008011357
Ensembl: ENSCSAG00000002338
UniProt: A0A0D9S4B2
LinkDB All DBs
Position
16
AA seq 952 aa AA seqDB search
MGVRHPLCSRRLLAICALVSLATAALLGHILLHDFLLVPRELSGSSSVLEETRPAHQQGA
SRPGPQNAQAHPGCPRAVPTQCDIPPNSRFDCAPDKAITQEQCEARGCCYIPAKQELRRT
QMGQPWCFFPPSYPSYKLENLSTSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANRRYEVPLETPRVPSRAVSPLYSVEFSKEPFGVIVRRQLDGHVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYVMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKV
WPGSTAFPDFTNPAALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPHNELEE
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASYRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLAASVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNGLLNLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPSGTWYDLETVPI
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARSNTIMNELVHVTSEGAGLQ
LQKVTVLGVATAPQQVLSNGAPVSNFTYSPDTKVLDIPVSLLVGEQFLISWS
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaggcacccgctctgctcccgccggctgctggccatctgtgcccttgtgtcc
ttggccactgctgcgctcctgggacacatcctgctccatgatttcctgctggttccccga
gaactgagtggatcctcctcagtcctggaggagactcgcccagctcaccagcagggagcc
agcaggccagggccccagaatgcccaggcacaccccggctgtcccagagcagtgcccaca
cagtgcgacatcccccccaacagccgcttcgactgtgcccctgacaaggctatcacccag
gaacagtgcgaggcccgcggctgctgctacatccctgcaaagcaggaacttcgaagaacc
cagatgggacagccctggtgcttcttcccacccagctaccccagctacaagctggagaac
ctgagcacctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttc
cccaaggacatcctgaccttgcggctggatgtgatgatggagactgagaaccgcctccac
ttcacaatcaaagatcccgctaacaggcgctacgaggtgcccttggagaccccacgtgtc
cccagccgggcagtgtccccactctacagcgtggagttctccaaggagcccttcggggtg
atcgtgcgccggcagctggacggccacgtgctgctgaacacgacggtggcgcccctgttc
tttgcggaccagttccttcagttgtccacctcgctgccctcgcagtacatcacaggactc
gccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaac
cgggacctcgcgcccacgcccggtgcgaacctctacgggtctcaccctttctacctggcg
ctggaggatggcgggtcggcacatggggtgttcctgctgaatagcaatgccatggatgtg
gtcctgcagccgagccctgcccttagctggaggtcgacaggtgggatcctggatgtgtac
atcttcctgggcccggagcccaagagcgtggtgcagcagtacctggatgttgtgggatac
ccgttcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctcc
actgccatcacccgccaggtggtggagaacatgaccagggcccacttccccctggacgtc
cagtggaacgacttggactacatggactcccggagggacttcacgttcaacaaggatggc
ttccgggacttcccagccatggtgcaggagctgcaccagggcggccgtcgctacgtgatg
attgtggatcctgccatcagcagctcaggccctgccgggagctacagaccctacgacgag
ggtctgcggaggggagttttcatcaccaatgagactggccagccactgattggaaaggtg
tggcctgggtccactgcctttcccgacttcaccaaccccgcagccctggcctggtgggag
gacatggtggctgagttccatgaccaggtgcccttcgacggcatgtggattgacatgaac
gagccttccaacttcatcaggggctctgaggacggctgcccccacaatgagctggaggag
ccaccctacgtgcctggggtggttggggggaccctccaggcggccaccatctgtgcctcc
agccaccagttcctctctacacactacaacctgcacaacctctacggcctgactgaagcc
atcgcctcctacagggcactggtgaaggctcgggggacacgcccgtttgtgatctcccgc
tcgacctttgctggccacggccgatatgccggccactggacgggggacgtgtggagctcc
tgggagcagctcgccgcctccgtgccagaaatcctgcagtttaacctgctgggggtgcct
ctggtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctgtgtgtgcgc
tggacccagctgggggccttctacccctttatgcggaaccacaatggcctgctcaatctg
ccccaggagccatacagtttcagcgagccggcccagcaggccatgaggaaggccctcacc
ctgcgctacgcactcctcccccacctctacacgctgttccaccaggcccacgtcgctggg
gagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtg
gaccaccagctcctgtggggggaggccctgctcatcaccccagtgctgcaggccgggaag
gccgaagtgaccggctacttcccctcaggcacatggtacgacctggagacggtgccaata
gaggcccttggcagcctcccgcccccacctgcagctccccgtgagccagccatccacagc
gaggggcagtgggtgacgctgccagcccccctggacaccatcaacgtccacctccgggct
gggtacatcatccccctgcagggccctggcctcacaaccacagagtcccgccagcagccc
atggccctggctgtggccctgaccaagggtggggaggcccgaggggagctgttctgggat
gatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatattcctggcc
aggagtaacacgatcatgaatgagctggtacatgtgaccagcgagggggctggcctgcag
ctgcagaaggtgaccgtcctgggcgtggccacagcgccccagcaggtcctctctaacggc
gcccctgtctccaacttcacctacagccccgacaccaaggtcctggacatccctgtctcg
ctgttggtgggagagcagtttctcatcagctggtcttag

DBGET integrated database retrieval system