KEGG   Chlorocebus sabaeus (green monkey): 103244520
Entry
103244520         CDS       T04361                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04060  Cytokine-cytokine receptor interaction
csab04151  PI3K-Akt signaling pathway
csab04630  JAK-STAT signaling pathway
csab04640  Hematopoietic cell lineage
csab04657  IL-17 signaling pathway
csab04658  Th1 and Th2 cell differentiation
csab04659  Th17 cell differentiation
csab04660  T cell receptor signaling pathway
csab04664  Fc epsilon RI signaling pathway
csab04672  Intestinal immune network for IgA production
csab05140  Leishmaniasis
csab05200  Pathways in cancer
csab05310  Asthma
csab05320  Autoimmune thyroid disease
csab05321  Inflammatory bowel disease
csab05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103244520 (IL4)
   04151 PI3K-Akt signaling pathway
    103244520 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103244520 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103244520 (IL4)
   04660 T cell receptor signaling pathway
    103244520 (IL4)
   04658 Th1 and Th2 cell differentiation
    103244520 (IL4)
   04659 Th17 cell differentiation
    103244520 (IL4)
   04657 IL-17 signaling pathway
    103244520 (IL4)
   04664 Fc epsilon RI signaling pathway
    103244520 (IL4)
   04672 Intestinal immune network for IgA production
    103244520 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103244520 (IL4)
  09163 Immune disease
   05310 Asthma
    103244520 (IL4)
   05320 Autoimmune thyroid disease
    103244520 (IL4)
   05321 Inflammatory bowel disease
    103244520 (IL4)
   05330 Allograft rejection
    103244520 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103244520 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csab04052]
    103244520 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:csab00536]
    103244520 (IL4)
Cytokines and growth factors [BR:csab04052]
 Cytokines
  Interleukins
   103244520 (IL4)
Glycosaminoglycan binding proteins [BR:csab00536]
 Heparan sulfate / Haparin
  Cytokines
   103244520 (IL4)
SSDB
Motif
Pfam: IL4 Mannosyl_trans3
Other DBs
NCBI-GeneID: 103244520
NCBI-ProteinID: XP_008012578
Ensembl: ENSCSAG00000013765
UniProt: A0A0D9RMS8
LinkDB
Position
23
AA seq 153 aa
MGLTSQLLPPLFFLLACAGNFVHGHNCHIALQEIIETLNSLTEQKTLCTKLTVTDILAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKKLIRFLKRLDRNLWGLAGL
SSCPVKEASQSTLEDFLERLKTIMKEKYSKCRS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac
tttgtccacggacacaactgccatatcgctttacaggagatcatcgaaactctgaacagc
ctcacagagcagaagactctgtgcaccaagttgaccgtaacggacatccttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgaccgtgctccggcagttctac
agccaccatgagaaggacactcgctgcctgggtgcaactgcacagcagttccacaggcac
aagaagctgatccgattcctgaaacggctcgacaggaacctctggggcctggcgggcttg
agctcctgtcctgtgaaggaagccagccagagtacgttggaagacttcttggaaaggcta
aagacgatcatgaaagagaaatattcaaagtgtcggagctga

DBGET integrated database retrieval system