KEGG   Chlorocebus sabaeus (green monkey): 103244714
Entry
103244714         CDS       T04361                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04010  MAPK signaling pathway
csab04014  Ras signaling pathway
csab04015  Rap1 signaling pathway
csab04151  PI3K-Akt signaling pathway
csab04390  Hippo signaling pathway
csab04810  Regulation of actin cytoskeleton
csab05200  Pathways in cancer
csab05218  Melanoma
csab05224  Breast cancer
csab05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103244714 (FGF1)
   04014 Ras signaling pathway
    103244714 (FGF1)
   04015 Rap1 signaling pathway
    103244714 (FGF1)
   04390 Hippo signaling pathway
    103244714 (FGF1)
   04151 PI3K-Akt signaling pathway
    103244714 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103244714 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103244714 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    103244714 (FGF1)
   05218 Melanoma
    103244714 (FGF1)
   05224 Breast cancer
    103244714 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csab04052]
    103244714 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:csab00536]
    103244714 (FGF1)
Cytokines and growth factors [BR:csab04052]
 Growth factors
  Growth factors (RTK binding)
   103244714 (FGF1)
Glycosaminoglycan binding proteins [BR:csab00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103244714 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103244714
NCBI-ProteinID: XP_008012979
Ensembl: ENSCSAG00000012382
UniProt: A0A0D9RIX8
LinkDB
Position
23
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFVERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccacgttcacagccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaacttctctactgtagcaacgggggccacttcttgaggatc
cttccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
gtggaaaggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaag
aattggtttgttggcctcaagaagaatggaagctgcaaacgcggtcctcggactcactat
ggccagaaagcaatcttgtttcttcccctgccagtctcttctgattaa

DBGET integrated database retrieval system