KEGG   Chlorocebus sabaeus (green monkey): 103244720
Entry
103244720         CDS       T04361                                 

Gene name
NR3C1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103244720 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csab03000]
    103244720 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:csab03310]
    103244720 (NR3C1)
Transcription factors [BR:csab03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103244720 (NR3C1)
Nuclear receptors [BR:csab03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   103244720 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 103244720
NCBI-ProteinID: XP_008013007
Ensembl: ENSCSAG00000012355
LinkDB
Position
23
AA seq 777 aa
MDSKESLTPSREENPSSVLAQERGNVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRR
LLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLK
LLEESIANLNRSTSVPENPKSSASTAVSAAPTKEFPKTHSDGSSEQQNLKGHTGTNGGNV
KLYTADQSTFDILQDLEFSSGSPGKGTNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNS
NEDCKPLILPDTKPKIKDNGDLVLSSPNNATLPQVKTEKEDFIELCTPGVIKQEKLGTVY
CQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGS
ENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPANKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSY
EEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggactccaaagaatcattaactcccagtagagaagaaaaccccagcagtgtgcttgct
caggagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtgaag
gtttctgcatcttcaccctcactggctgtcgcttctcagtcagactccaagcagcgaaga
cttttggttgattttccaaaaggctcagtaagcaatgcgcagcagccagatctctccaaa
gcagtttcactctcaatgggactgtatatgggagagacagaaacaaaagtgatgggaaat
gacctgggattcccacagcagggccaaatcagcctttcctcgggggaaacagacttaaag
cttttggaagaaagcattgcaaacctcaataggtcgaccagtgttccagagaaccccaag
agttcagcatccactgctgtgtctgctgcccccacaaaggagtttccaaaaactcactct
gatggatcttcagaacagcaaaatttgaagggccatactggcaccaacggcggcaatgtg
aaattgtataccgcagaccaaagcacctttgacattttgcaggatttggagttttcttct
gggtccccaggtaaagggacgaatgagagtccttggagatcagacctgttgatagatgaa
aactgtttgctttctcctctggcgggagaagacgattcattccttttggaaggaaattcg
aatgaggactgcaagcctctcattttaccggacactaaacccaaaattaaggataatgga
gatctggttttgtcaagccccaataatgcaacactgccccaagtgaaaacagaaaaagaa
gatttcatcgaactctgcacccctggggtaattaagcaagagaaactgggcacagtttac
tgtcaggcgagctttcctggagcaaatataattggtaataaaatgtctgccatttctgtt
catggtgtgagtacctctggaggacagatgtaccactatgacatgaatacagcatccctt
tctcaacagcaggatcagaagcctatttttaatgtcattccaccaattcccgttggttct
gaaaattggaataggtgccaaggttctggagacgacaacttgacttccttggggactctg
aacttccctggtcgaacagttttttctaatggctattcaagccccagcatgagaccagat
gtaagctctcctccatccagctcctcaacagcaacaacaggaccacctccgaaactctgc
ctggtgtgctctgatgaagcatcaggatgtcattatggagtcttaacttgtggaagctgt
aaagttttcttcaaaagagcagtggaaggtagacagcacaattacctatgtgctggaagg
aatgattgcatcatcgataaaattcgaagaaaaaactgcccagcatgccgctatcgaaaa
tgtcttcaggctggaatgaacctggaagctcgaaaaacaaagaaaaaaataaaaggaatt
cagcaggccactacaggagtctcacaagaaacctctgaaaatcctgctaacaaaacaata
gttcctgcaacgttaccacaactcacccctaccctggtgtcactgttggaggttattgaa
cctgaagtgttatatgcaggctatgatagctctgttccagactcaacttggaggatcatg
accacgctcaacatgttaggagggcggcaagtgattgcagcagtgaaatgggcaaaagcg
ataccaggtttcaggaacttacacctggatgaccaaatgaccctactgcaatactcctgg
atgtttcttatggcatttgccctggggtggagatcatatagacaatcaagtgcaaacctg
ctgtgttttgctcctgatctgattattaatgagcagagaatgactctaccctgcatgtac
gaccaatgtaaacacatgctgtatgtttcctctgagttacacaggcttcaggtatcttac
gaagaatatctctgtatgaaaaccttactgcttctctcttcagttcctaaggacggtctg
aagagccaagagctatttgatgaaattagaatgacctacatcaaagagctaggaaaagcc
attgtcaagagggaaggaaactccagccagaactggcagcggttttatcaactgacaaaa
ctcttggattctatgcatgaagtggttgaaaatcttcttaactattgcttccaaacattt
ttggataagaccatgagtattgaattcccagagatgttagctgaaatcatcaccaatcag
ataccaaaatattcaaatggaaatatcaaaaaacttctgtttcatcaaaagtga

DBGET integrated database retrieval system