KEGG   Chlorocebus sabaeus (green monkey): 103245586Help
Entry
103245586         CDS       T04361                                 

Gene name
PIGB
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class B
  KO
K05286  GPI mannosyltransferase 3 [EC:2.4.1.-]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
csab01100  Metabolic pathways
Module
csab_M00065  GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    103245586 (PIGB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csab01003]
    103245586 (PIGB)
Enzymes [BR:csab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     103245586 (PIGB)
Glycosyltransferases [BR:csab01003]
 GPI-anchor biosynthesis
  Core oligosaccharide
   103245586 (PIGB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_22 PMT_2
Motif
Other DBs
NCBI-GeneID: 103245586
NCBI-ProteinID: XP_008014712
Ensembl: ENSCSAG00000011658
LinkDB All DBs
Position
26
AA seq 551 aa AA seqDB search
MERGREDASLTLRGLQNRSHEKIKLRKRKSTLYFSTQEKNARRRGDLLGENIHLVLFTIA
LRILNCFLVQTSFVPDEYWQSLEVAHHMVFNYGYLTWEWTERLRSYTYPLIFASIYKILH
LLGKDSVQLLIWIPRLAQALLSAVADVRLYSLMKQLVNQEVARWVFFCQLCSWFTWYCCT
RTLTNTMETVLTIIALFYYPLEGSKSMNSVKYSSLVALAFIIRPTAVIPWTPLLFRHFCQ
EPRKLDLILHHFLPVGFATLSLSLMIDRIFFGQWTLVQFNFLKFNVLQNLGTFYGSHPWH
WYFSQGFPVILGTHLPFFIHGCYLAPKRHRILLVTVLWTLLVYSMLSHKEFRFIYPVLPF
CMVFCGYSLTHLKTWKKPALSFLFLSNLFLALYTGLVHQRGTLDVMSHIQKVCYNNPNKS
SASIFIMMPCHSTPYYSHVHCLLPMRFLQCPPDLTGKSQYLDEADVFYLNPLNWLHREFH
DDASLPTHLITFSILEEEISAFLISSNYNRTAVFFHTHLPEGRIGSHVYVYERKLKGKFN
TKTNSELSEIN
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggagcggggacgcgaagatgccagcctcactttgcgtggtctccagaaccgctcccac
gagaagataaagctgcgaaagagaaagtctaccttgtacttcagcacccaggagaagaac
gccaggcgccgcggggatcttcttggagagaatattcatctggtcttgttcaccatagct
ttacgaatattaaactgctttttagtgcaaacaagctttgttccagatgaatactggcag
tctcttgaagttgcacatcacatggttttcaattatggttatttgacttgggaatggaca
gagagattgaggagttacacttatcccttaatctttgcaagcatttacaagattcttcat
cttttagggaaagatagtgttcagttgctgatttggattcctagacttgcccaagcactt
ctgtctgctgtagcagacgtgagactttactcattaatgaagcaactagtaaatcaggaa
gtggcaagatgggtgtttttttgccagttgtgctcctggttcacatggtattgctgtacc
agaacccttacaaacaccatggaaactgttctcactataattgctcttttctactatcct
ttggaaggttcaaagtctatgaacagtgtcaagtactcatccttggtggcacttgccttc
ataattcgtcccacagctgtcattccctggacacctttgctcttcagacatttctgtcaa
gaaccaagaaagcttgatcttattctacatcattttttacctgtaggctttgctactttg
agtttgtctctgatgattgatcgtattttttttggccaatggactctggttcaatttaat
tttttgaaatttaacgtgctgcagaacttgggaacattttatggttctcatccatggcac
tggtacttcagtcaaggatttccagttatcttgggtactcacttacccttctttattcat
ggctgctatctagcaccaaagagacaccggatacttttggtgactgtgctatggacactg
cttgtttatagcatgttgagccacaaagaattcaggtttatttatccagttttaccattc
tgtatggtgttctgtggatattcactaacccacctgaaaacatggaagaaaccagctctg
agtttcctgtttttatcaaatttgttcctcgccctttatactggtttagttcatcaacga
ggtactcttgatgtcatgagtcatattcaaaaagtttgttacaacaatcctaataaatct
tcagcttcaatatttataatgatgccttgccactctactccttattacagccatgttcac
tgcctacttcccatgagatttctccagtgccccccagacctgactggaaaaagtcagtat
cttgatgaagcagatgtattttacctaaatcccttaaactggttacacagagagtttcat
gacgatgcatcattgcctactcacttgatcaccttcagcattttggaagaggaaataagt
gctttcctaatttcaagcaattataacagaactgctgttttcttccacactcacttgccg
gagggtcgaattggaagtcacgtatatgtctatgaacggaagttaaaagggaaattcaac
acgaagacgaattctgaactttctgagataaactaa

DBGET integrated database retrieval system