KEGG   Chlorocebus sabaeus (green monkey): 103245614Help
Entry
103245614         CDS       T04361                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:csab00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    103245614 (MAPK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csab01001]
    103245614 (MAPK6)
Enzymes [BR:csab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103245614 (MAPK6)
Protein kinases [BR:csab01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103245614 (MAPK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 103245614
NCBI-ProteinID: XP_008014779
Ensembl: ENSCSAG00000011360
UniProt: A0A0D9RG14
LinkDB All DBs
Position
26
AA seq 721 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPIHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTSYS
TEPCWQYSDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQ
HEPTDVVDKLNDLNSSVSQLELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSG
GEDCFLINQFCEVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEAG
FLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHKTYSSILKHL
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaatttgaaagtctcatgaacattcatggttttgatctgggttctaggtat
atggacttaaaaccattgggttgtggaggcaatggcttggttttttctgctgtagacaat
gactgtgacaaaagagtagccatcaagaaaattgtccttactgatccccagagtgtcaaa
catgctctacgtgaaatcaaaattattagaagacttgaccatgataacattgtgaaagtg
tttgaaattcttggtcctagtggaagccaattaacagacgatgtgggctcgcttacggaa
ctgaacagtgtttacattgttcaggagtacatggagacagacttggctaatgtgctggag
cagggccctttactggaagagcatgccaggctgttcatgtatcagctgctacgggggctc
aagtatattcactctgcaaacgtactgcacagagatctcaaaccagctaatcttttcatt
aatactgaagacttggtgctgaagataggtgactttggtcttgcacggatcatggatcct
cattattcccataagggtcatctttctgaaggattggttactaaatggtacagatctcca
cgtcttttactttctcctaataattatactaaagccattgacatgtgggctgcaggctgc
atctttgctgaaatgctgactggtaaaaccctttttgcaggtgcacatgaacttgaacag
atgcagctgattttagaatctattcctgttgtacatgaggaagatcgtcaggagcttctc
agcgtaattccagtttacattagaaatgacatgactgagccacacaaacctttaactcag
ctgcttccaggaattagtcgagaagcactggatttcctggaacaaattttgacatttagc
cccatggatcggttaacagcagaagaagcgctctcccatccttacatgagcatatattct
tttccaatggatgagcctatttcaagccatccttttcatattgaagatgaagttgatgat
attttgcttatggatgaaactcacagtcacatttataactgggaaaggtatcatgattgt
cagttttcagagcatgattggcctatacataacaactttgatattgatgaggttcagctt
gatccaagagctctgtccgatgtcactgatgaagaagaagtacaagttgatccccgaaaa
tatttggatggagatcgggaaaagtatctagaggatcctgcttttgataccagttactct
actgagccttgttggcaatactcagatcatcacgaaaacaaatattgtgatctggagtgt
agccatacttgtaactacaaaacgaggtcgtcatcatatttagataacttagtttggaga
gagagtgaagttaaccattactatgaacccaagcttattatagatctttccaattggaaa
gaacaaagcaaagaaaaatctgataagaaaggcaaatcaaaatgtgaaaggaatggattg
gttaaagcccagatagcactagaggaagcatcacagcaactggctggaaaagaaagggaa
aagaatcagggatttgattttgattcctttattgcaggaactattcaacttagttcccaa
catgagcctactgatgttgttgataaattaaatgacttgaatagctcagtgtcccaacta
gaattgaaaagtttgatatcaaagtcagtaagccaagaaaaacaggaaaaaggaatggca
aatctggctcaattagaagccttgtaccaatcttcttgggacagccagtttgtgagtggt
ggggaggactgttttctcatcaatcagttttgtgaggtaaggaaggatgaacaagttgag
aaggaaaacacttacactagttacttggacaagttctttagcaggaaagaagatactgaa
atgctagaaactgagccagtagaggatgggaagcttggggagagaggacatgaggcaggc
tttctgaacaacagtggggagttcctctttaacaagcagctcgagtccataggcatcccg
cagtttcacagtccagttgggtcaccacttaagtctatacaggccacattaacaccttct
gctatgaaatcttcccctcaaattcctcataaaacatacagcagcattctgaaacatctg
aactaa

DBGET integrated database retrieval system