KEGG   Chlorocebus sabaeus (green monkey): 103245712Help
Entry
103245712         CDS       T04361                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00040  Pentose and glucuronate interconversions
csab00051  Fructose and mannose metabolism
csab01100  Metabolic pathways
Module
csab_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    103245712 (SORD)
   00051 Fructose and mannose metabolism
    103245712 (SORD)
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     103245712 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 SpoVS Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 103245712
NCBI-ProteinID: XP_008014963
Ensembl: ENSCSAG00000009647
LinkDB All DBs
Position
26
AA seq 357 aa AA seqDB search
MAAAAKPKNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEEGRIGNF
IVKKPMVLGHEASGTVEKVGSLVKHLKPGDRVAIEPGVPRENDEFCKSGRYNLSPSIFFC
ATPPDDGNLCRFYKHNAAFCYKLPDNVTYEEGALIEPLSVGIHACRRGGVTLGHRVLVCG
AGPIGVVSLLVAKAMGAAQVVVTDLSAPRLSKAKEIGADLVLQISKESPQEIAGKVEGLL
GCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTIPLLHAAVREVDIKGVFRY
CNTWPVAISMLASKSVNIKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPNDQNP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggccaagcccaagaacctttccctggtggtgcacggaccgggtgacttg
cgcctggagaactatcccatccctgaaccaggcccaaatgaggtgttgctgaggatgcat
tctgttggaatctgtggctcagatgtccactactgggaggagggtcgaattgggaatttt
atcgtgaaaaagcccatggtgctgggacatgaagcttcaggaacggtcgaaaaagtggga
tcgttggtaaagcacctaaaaccaggtgaccgtgttgccattgagcctggtgttccccga
gaaaatgatgaattttgcaagtcaggccgatacaatctgtcaccttccatcttcttctgt
gccacaccccccgatgacggaaacctctgccggttctacaagcacaatgcagccttttgt
tacaagcttcctgacaatgtcacctatgaggaaggcgccctgattgagccactttctgtg
gggatccatgcctgcaggagaggtggagttaccctgggacacagggtccttgtgtgtgga
gctgggccaatcggggtggtctctttgctggtggccaaggcaatgggagcagctcaagta
gtggtgactgacctgtctgctccccggttgtccaaagccaaggagattggggctgattta
gtcctccagatctccaaggagagtcctcaggaaatcgccggtaaagtagaaggtctgctg
gggtgcaagccggaagtcaccatcgagtgcacgggggcagaggcctccatccaggcgggc
atctacgccactcgctctggtgggaccctggtgcttgtggggctgggctctgagatgacc
accatacccctactgcatgcagccgtccgggaggtggatatcaagggcgtgtttcgatac
tgcaacacgtggccagtggcgatttcgatgcttgcgtccaagtctgtgaacataaaaccc
ctcgtcacccatagatttcctctggagaaagctctggaagcctttgaaacatttaaaaag
ggattggggttgaaaatcatgctcaagtgtgatcccaatgaccagaatccctga

DBGET integrated database retrieval system