KEGG   Chlorocebus sabaeus (green monkey): 103245770Help
Entry
103245770         CDS       T04361                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab00052  Galactose metabolism
csab00500  Starch and sucrose metabolism
csab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103245770 (GANC)
   00500 Starch and sucrose metabolism
    103245770 (GANC)
Enzymes [BR:csab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103245770 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103245770
NCBI-ProteinID: XP_008015097
LinkDB All DBs
Position
26
AA seq 357 aa AA seqDB search
MEAAEKEEISVEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSAYQALLDSVTTDEDSTRFQ
IINEASKVTLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGS
LILADGKGGLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEKEA
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDEDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLSQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTDIGEK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctgagaaagaggaaataagcgttgaagatgaagctgtggataaaaacatt
ttcagagactgcaacaagatcgcattttacaggcgtcagaaacagtggctttccaagaag
tccgcctatcaggcattactggactcagtcacaacagatgaagacagcaccaggttccaa
atcatcaatgaagcaagtaaggttactctcctggctgaaatttatggtatagaaggaaac
attttcaggcttaaaattaatgaagagactcctctaaaacccaggtttgaagttcctgat
gtcctcacaagcaagccaagcactgtaaggctgatttcatgctcaggggacacagggagt
ctgatattggcagatggaaaaggaggcctgaagtgccatatcacagcaaacccattcaag
gtagacttggtgtctgaagaagaggttgtgattagcataaattccctgggccagttatac
tttgagcatctacagattcttcacaaacaaagagctgctaaagaaaatgagaaggaggca
tcagtggacacctctcaggaaaatcaagaggatctaggcctgtgggaagagaaatttgga
aaatttgtggatatcaaagctaatggtccttcttccattggtttggatttctccttgcat
ggatttgagcatctctatgggatcccacaacatgcagaatcacaccaacttaaaaatact
ggtgatgaagatgcttaccgtctttataacctagatgtctatggataccaaatatatgat
aaaatgggcatttatggttcagtaccttatctcctggcccacaaactgggcagaactata
ggcattttctggctgaatgcctcagaaacgctggtggagatcaatacagagcctgcagta
gagtatacactgtcccagatgggcccagttgctgctaaacaaaaggtcagatctcgaact
catgtgcactggatgtcagaaagtggaatcattgatgtttttctgctaacaggacctaca
ccttctgatgtcttcaaacagtactcacaccttacagacattggagaaaaatag

DBGET integrated database retrieval system