KEGG   Chlorocebus sabaeus (green monkey): 103246306Help
Entry
103246306         CDS       T04361                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:csab00001]
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    103246306 (TGM2)
Enzymes [BR:csab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103246306 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 103246306
NCBI-ProteinID: XP_008015992
Ensembl: ENSCSAG00000013732
UniProt: A0A0D9RMQ2
LinkDB All DBs
Position
2
AA seq 687 aa AA seqDB search
MAEDLILERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDLEEERQEYVLTQQGFIYQGSAKFIKSIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDSSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVSKSINRSL
TVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKHLLNLNLEPFSEK
SIPLCILYEKYRDCLTESNLIKVRALLVEPVINSYLLAERDLYLENPEIKIRILGEPKQK
RKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLPLHMG
LHKLVVNFESDKLKAVKGFRNVIIGPA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggatctgatcttggagaggtgtgatctggagctggagaccaatggccgagac
caccacacagccgacctgtgccgggagaagctggtggtgcgacggggccagcccttctgg
ctgacgctgcactttgagggtcgcaactacgaggccagtgtagacagtcttaccttcagt
gtcgtgactggcccagctcccagccaggaggccgggaccaaggcccgttttccactacga
gatgctgtggaggagggtgactggacggccaccgtggtggaccagcaagactgcaccctc
tcactgcagctcaccaccccggccaacgcccccatcggcctgtatcgcctcagcctggag
gcctccactggctaccagggatccagctttgtgctgggccacttcatcttgctcttcaat
gcctggtgcccagcggacgctgtgtacctggacttggaagaggagcggcaggagtacgtc
ctcacccagcagggctttatctaccagggctcggccaagttcatcaagagcataccttgg
aattttgggcagtttgaagatgggatcctagacatctgcctgatccttctagatgtcaac
cccaagttcctgaagaacgccggccgtgactcctctcgccgcagcagccccgtctacgtg
ggccgggtggtgagcggcatggtcaactgcaacgatgaccagggtgtgctgctgggacgc
tgggacaacaactacggggacggtgtcagtcccatgtcctggatcggcagtgtggacatc
ctgcggcgctggaagaaccatggctgccagcgcgtcaagtacggccagtgctgggtcttt
gccgccgtggcctgcacagtgctgaggtgcctgggcatccccacccgcgtcgtgaccaac
tacaactcagcccatgaccagaacagcaaccttctcatcgagtacttccgcaatgagttt
ggggagatccagggtgacaagagcgagatgatctggaacttccactgctgggtggagtca
tggatgaccaggccggacctgcagccagggtacgagggctggcaggccctggacccaacg
ccccaggagaagagcgaagggacgtactgctgtggcccagttccagttcgtgccatcaag
gagggcgacctgagcaccaagtacgacgcgccctttgtctttgcggaggtcaatgccgac
gtggtagactggatccagcaggacgacgggtccgtgagcaaatccatcaaccgttccctg
accgttgggctgaagatcagcactaagagtgtgggccgagacgagcgggaggatatcacc
cacacctacaaatacccagaggggtcctcagaggagagggaggccttcacaagggccaac
cacctgaacaaactggccgagaaggaggagacggggatggccatgcggatccgggtgggc
cagagcatgaacatgggcagtgactttgacgtctttgcccacatcaccaacaacaccgcc
gaggagtacgtctgccgcctcctgctctgcgcccgcaccgtcagctacaatgggatcttg
gggcccgagtgtggcaccaagcacctgctcaacctcaacctggagcctttctctgagaag
agcattcctctttgcatcctctatgagaagtaccgtgactgcctcacagagtccaacctc
atcaaggtgcgggccctgctcgtggagccagttatcaacagctacctgctggctgagagg
gacctctacctggagaatccagaaatcaagatccggatccttggggagcccaaacagaaa
cgcaagctggtggccgaagtgtccctgcagaacccgctccctgtggccctggaaggctgc
accttcactgtggagggggccgggctaaccgaggagcagaagacagtggagatcccagac
cccgtggaggcaggggaggaagttaaggtgagaatggacctgctgccgctccacatgggc
ctccacaagctggtggtgaacttcgagagcgacaagctgaaggctgtgaagggcttccgg
aatgtcatcattggccccgcctaa

DBGET integrated database retrieval system