KEGG   Chlorocebus sabaeus (green monkey): 103246443Help
Entry
103246443         CDS       T04361                                 

Definition
(RefSeq) homeobox protein NANOG-like
  KO
K10164  homeobox protein Nanog
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04550  Signaling pathways regulating pluripotency of stem cells
csab05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103246443
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103246443
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csab03000]
    103246443
Transcription factors [BR:csab03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    103246443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homez
Motif
Other DBs
NCBI-GeneID: 103246443
NCBI-ProteinID: XP_008016271
Ensembl: ENSCSAG00000018961
LinkDB All DBs
Position
1
AA seq 281 aa AA seqDB search
MPVICGPGENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTAAENSA
TKKEDKVPVKKQKARTVFSSAQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQ
NQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSPYSSCHQGCLVNPTGNLPTWSNQTWNNS
SWSNQTQNIQSWSNHSWNAQTWCTQSWNNQAWNSPFYNCGEESLQSCLQFQPNSPASDLE
AALEAAGEGLNVIQQTTRYLSTPQTMDLFLNYSTNMQPEDV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgatttgtgggcctggagaaaactatccatccttgcaaatgtcttctgctgag
atgcctcacacggagactgtctctcctcttccttcctccatggatctgcttattcaggac
agccccgattcttccaccagtcccaaaggcaaacaacctactgctgcagagaatagtgcc
acaaaaaaggaagacaaggtcccggtcaagaaacagaaggccagaactgtgttctcttcc
gcccagctgtgtgtactcaatgatagatttcagagacagaaatacctcagcctgcagcag
atgcaagaactttccaacatcctgaacctcagttacaaacaggtgaagacctggttccag
aatcagagaatgaaatctaagaggtggcagaaaaacaactggccaaagaatagcaatggt
gtgactcagaaggcctcagcacctacctaccccagcccctactcttcctgccaccaggga
tgcctggtaaacccgactgggaaccttccgacatggagcaaccagacctggaacaattca
tcctggagcaaccagacccagaacatccagtcctggagcaaccactcctggaacgctcag
acctggtgcacccagtcctggaacaatcaggcctggaacagtcccttctataactgtgga
gaggaatctctgcagtcctgcttgcagttccagccaaattctcctgccagtgacttggag
gctgccttggaagctgctggggaaggccttaatgtaatacagcagacgactaggtatttg
agtactccacaaaccatggatttattcctaaactactccacgaacatgcaacctgaagat
gtgtga

DBGET integrated database retrieval system