KEGG   Chlorocebus sabaeus (green monkey): 103246489
Entry
103246489         CDS       T04361                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab01522  Endocrine resistance
csab04068  FoxO signaling pathway
csab04110  Cell cycle
csab04115  p53 signaling pathway
csab04151  PI3K-Akt signaling pathway
csab04152  AMPK signaling pathway
csab04218  Cellular senescence
csab04310  Wnt signaling pathway
csab04340  Hedgehog signaling pathway
csab04371  Apelin signaling pathway
csab04390  Hippo signaling pathway
csab04510  Focal adhesion
csab04530  Tight junction
csab04630  JAK-STAT signaling pathway
csab04917  Prolactin signaling pathway
csab04919  Thyroid hormone signaling pathway
csab04921  Oxytocin signaling pathway
csab04933  AGE-RAGE signaling pathway in diabetic complications
csab04934  Cushing syndrome
csab05160  Hepatitis C
csab05162  Measles
csab05163  Human cytomegalovirus infection
csab05165  Human papillomavirus infection
csab05166  Human T-cell leukemia virus 1 infection
csab05167  Kaposi sarcoma-associated herpesvirus infection
csab05169  Epstein-Barr virus infection
csab05200  Pathways in cancer
csab05203  Viral carcinogenesis
csab05205  Proteoglycans in cancer
csab05206  MicroRNAs in cancer
csab05210  Colorectal cancer
csab05212  Pancreatic cancer
csab05213  Endometrial cancer
csab05214  Glioma
csab05215  Prostate cancer
csab05216  Thyroid cancer
csab05218  Melanoma
csab05219  Bladder cancer
csab05220  Chronic myeloid leukemia
csab05221  Acute myeloid leukemia
csab05222  Small cell lung cancer
csab05223  Non-small cell lung cancer
csab05224  Breast cancer
csab05225  Hepatocellular carcinoma
csab05226  Gastric cancer
csab05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103246489 (CCND1)
   04340 Hedgehog signaling pathway
    103246489 (CCND1)
   04390 Hippo signaling pathway
    103246489 (CCND1)
   04371 Apelin signaling pathway
    103246489 (CCND1)
   04630 JAK-STAT signaling pathway
    103246489 (CCND1)
   04068 FoxO signaling pathway
    103246489 (CCND1)
   04151 PI3K-Akt signaling pathway
    103246489 (CCND1)
   04152 AMPK signaling pathway
    103246489 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103246489 (CCND1)
   04115 p53 signaling pathway
    103246489 (CCND1)
   04218 Cellular senescence
    103246489 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103246489 (CCND1)
   04530 Tight junction
    103246489 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103246489 (CCND1)
   04921 Oxytocin signaling pathway
    103246489 (CCND1)
   04919 Thyroid hormone signaling pathway
    103246489 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103246489 (CCND1)
   05206 MicroRNAs in cancer
    103246489 (CCND1)
   05205 Proteoglycans in cancer
    103246489 (CCND1)
   05203 Viral carcinogenesis
    103246489 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103246489 (CCND1)
   05212 Pancreatic cancer
    103246489 (CCND1)
   05225 Hepatocellular carcinoma
    103246489 (CCND1)
   05226 Gastric cancer
    103246489 (CCND1)
   05214 Glioma
    103246489 (CCND1)
   05216 Thyroid cancer
    103246489 (CCND1)
   05221 Acute myeloid leukemia
    103246489 (CCND1)
   05220 Chronic myeloid leukemia
    103246489 (CCND1)
   05218 Melanoma
    103246489 (CCND1)
   05219 Bladder cancer
    103246489 (CCND1)
   05215 Prostate cancer
    103246489 (CCND1)
   05213 Endometrial cancer
    103246489 (CCND1)
   05224 Breast cancer
    103246489 (CCND1)
   05222 Small cell lung cancer
    103246489 (CCND1)
   05223 Non-small cell lung cancer
    103246489 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103246489 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103246489 (CCND1)
   04934 Cushing syndrome
    103246489 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103246489 (CCND1)
   05162 Measles
    103246489 (CCND1)
   05160 Hepatitis C
    103246489 (CCND1)
   05163 Human cytomegalovirus infection
    103246489 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103246489 (CCND1)
   05169 Epstein-Barr virus infection
    103246489 (CCND1)
   05165 Human papillomavirus infection
    103246489 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103246489 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103246489
NCBI-ProteinID: XP_008016385
Ensembl: ENSCSAG00000009273
UniProt: A0A0D9RA90
LinkDB
Position
1
AA seq 295 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVVPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLGSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaaaccatccgccgcgcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaaatgtgtgcagaaggaggtcgtgccgtccatgcggaagatcgtc
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctctaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacaccgacaactccatccggcccgaggagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggctgccatgaccccgcacgatttc
atcgaacacttcctttccaaaatgccagaggcggaggagaacaaacagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaatccaccc
tccatggtggcagcagggagcgtggtggccgcagtgcaaggcctgaacctggggagcccc
aacaacttcctgtcctactaccgcctcacacgcttcctctccagagtgatcaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtcaagcctgcgc
caggcccagcagaacatggaccccaaggccgccgaggaggaggaggaagaggaggaggag
gtggacctggcttgcacacccaccgacgtgcgggacgtggacatctga

DBGET integrated database retrieval system