KEGG   Chlorocebus sabaeus (green monkey): 103246719
Entry
103246719         CDS       T04361                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04060  Cytokine-cytokine receptor interaction
csab04066  HIF-1 signaling pathway
csab04151  PI3K-Akt signaling pathway
csab04630  JAK-STAT signaling pathway
csab04640  Hematopoietic cell lineage
csab05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103246719 (EPO)
   04066 HIF-1 signaling pathway
    103246719 (EPO)
   04151 PI3K-Akt signaling pathway
    103246719 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103246719 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103246719 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103246719 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csab04052]
    103246719 (EPO)
Cytokines and growth factors [BR:csab04052]
 Cytokines
  CSF and other factors
   103246719 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 103246719
NCBI-ProteinID: XP_008016708
Ensembl: ENSCSAG00000017939
UniProt: A0A0D9RZB9
LinkDB
Position
28
AA seq 192 aa
MGVHECPAWLWLLLSLLWLPLGLPVPGAPPRLICDSRVLERYLLEAKEAENVTTGCSESC
SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQL
HVDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLK
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgcacgaatgtcctgcctggctgtggcttctcctgtccctgctgtggctccct
ctgggcctcccagtcccgggcgccccaccacgcctcatctgtgacagccgagtcctggag
aggtacctcttggaggccaaggaggccgagaatgtcacgacgggctgttccgaaagctgc
agcttgaatgagaatatcaccgtcccagacaccaaagttaacttctatgcctggaagagg
atggaggtcgggcagcaggctgtagaagtctggcagggcctggccctgctctcggaagct
gtcctgcggggccaggccgtgttggccaactcttcccagcctttcgagcccctgcagctg
cacgtggataaagccatcagtggccttcgcagcatcaccactctgcttcgggcgctggga
gcccaggaagccatctcccttccagatgcggcctcggctgctccactccgaacaatcact
gctgacactttctgcaaactcttccgagtctactccaatttcctccggggaaagctgaag
ctgtacacgggggaggcctgcaggagaggggacagatga

DBGET integrated database retrieval system