KEGG   Chlorocebus sabaeus (green monkey): 103247515
Entry
103247515         CDS       T04361                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04060  Cytokine-cytokine receptor interaction
csab04151  PI3K-Akt signaling pathway
csab04210  Apoptosis
csab04630  JAK-STAT signaling pathway
csab04640  Hematopoietic cell lineage
csab05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:csab00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103247515 (IL3RA)
   04151 PI3K-Akt signaling pathway
    103247515 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103247515 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103247515 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103247515 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103247515 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:csab04050]
    103247515 (IL3RA)
   04090 CD molecules [BR:csab04090]
    103247515 (IL3RA)
Cytokine receptors [BR:csab04050]
 Interleukin receptor families
  IL3 receptor family
   103247515 (IL3RA)
CD molecules [BR:csab04090]
 Proteins
  103247515 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind DUF4812 CRAM_rpt BclA_C
Other DBs
NCBI-GeneID: 103247515
NCBI-ProteinID: XP_008017843
LinkDB
Position
Un
AA seq 281 aa
MKEKAQQLMWDLNRNVTGVECIKGTDYSMPAMNSSYCQFGAISLCEVTNYTVRVASPPFS
TWILFPENTGMPRAGAENLTCWVHDVDFLSCSWAAGPAAPADVQYDLYLNNPNSHEQHRC
LHYKTDARGTQIGCRFEDIARLSRGSQSSHILVRGRSAAFSIPCTDKFVFFSEIETLTPP
NMTGECNETHSFMHWEMRSHFNRKFRYQLRIQKRMQPVRTEQVSVPYPQTLHLTLQRVRD
TTSFQLPNPGTYTVQIRAQETMYEFSSAWSTPQRFGEWGVG
NT seq 846 nt   +upstreamnt  +downstreamnt
atgaaagaaaaggctcagcagttgatgtgggacctgaacagaaacgtgaccggcgtggag
tgtatcaaaggcaccgactattctatgccggcaatgaacagcagctattgccagttcgga
gccatttccttatgtgaagtgaccaactacaccgtccgagtggccagtcccccgttctcc
acgtggatcctcttccctgagaacactgggatgcctcgggccggtgcggaaaatctgacc
tgctgggttcatgatgtggatttcttgagctgcagctgggcggcaggcccagcggctccc
gctgacgtccagtacgacctgtacttgaacaatcccaacagccacgaacagcacaggtgt
cttcactacaaaacggatgctcggggaacacagatcgggtgtcggttcgaggacatcgct
cgactctcccgcggttctcaaagttcccacatcctggtgaggggcaggagcgcagccttc
agtatcccctgcacagataagtttgtcttcttttcagagattgagacattaactccaccc
aacatgactggagagtgtaatgagacacattccttcatgcactgggaaatgagaagtcat
ttcaatcgcaaatttcgctatcagcttcggatccaaaagagaatgcagcctgtaaggaca
gaacaggtgagtgttccctacccccagacgctgcacttgacattgcaaagggtcagagac
acaacctccttccagctacccaatcctggaacgtacacagtgcaaataagagcccaggaa
acaatgtatgaattctcgagtgcctggagcaccccccagcgcttcggtgagtggggagtg
gggtga

DBGET integrated database retrieval system