KEGG   Chlorocebus sabaeus (green monkey): 103248206Help
Entry
103248206         CDS       T04361                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
csab04146  Peroxisome
csab04213  Longevity regulating pathway - multiple species
csab05014  Amyotrophic lateral sclerosis (ALS)
csab05016  Huntington disease
csab05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:csab00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103248206
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    103248206
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    103248206
   05016 Huntington disease
    103248206
   05020 Prion diseases
    103248206
Enzymes [BR:csab01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103248206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 103248206
NCBI-ProteinID: XP_008018672
LinkDB All DBs
Position
1
AA seq 154 aa AA seqDB search
MAMKAVCVLKGNSPVQGTINFEQKESNGPVKVWGSITGLTEGLHGFHVHQFGDNTQGCTS
AGPHFNPLSRQHGGPKDEERHVGDLGNVTAGKDGVANVSFEDSVISLSGDHSIIGRTLVV
HEKADDLGKGGNEESKKTGNAGGRLACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaggccgtgtgcgtgttgaagggcaacagcccagtgcagggcaccatcaat
ttcgagcagaaggaaagtaatggaccagtgaaggtgtggggaagcataacaggattgact
gaaggcctgcatggattccatgttcatcagtttggagataatacacaaggctgtaccagt
gcaggtcctcactttaatcctctatccagacaacacggtgggccaaaggatgaagagagg
catgttggagacctgggcaatgtgaccgctggcaaagatggtgtggccaatgtgtctttc
gaagattctgtgatctcactctcaggagaccattccatcattggccgcacactggtggtc
catgaaaaagcagatgacttgggcaaaggtggaaatgaagaaagtaaaaagacaggaaat
gctggaggtcgtctggcttgtggtgtaattgggatcgcccaataa

DBGET integrated database retrieval system