KEGG   Camelina sativa (false flax): 104700495Help
Entry
104700495         CDS       T05044                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 2, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00020  Citrate cycle (TCA cycle)
csat00190  Oxidative phosphorylation
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104700495
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104700495
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104700495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 GIDA DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 104700495
NCBI-ProteinID: XP_010414323
LinkDB All DBs
Position
1
AA seq 630 aa AA seqDB search
MWRCLRVASSRRSESNGAFVTSQLSRFFSTPSTGDRSSYTIVDHTYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
DAIQFMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCSCAADRT
GHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFHAGSTILA
TGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGARGEG
GILRNSEGEKFMDRYAPTARDLASRDVVSRSMTMEIRQGRGAGPMKDHIYLHLNHLPSEV
LKERLPGISETAAIFAGVDVTREPIPVLPTVHYNMGGIPTNYHGEVVTVRGDDTDAIVPG
LMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQKPGEILKPLEKDAGEKSIK
WLDRIRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCDLMDKTWDSFGDVKVTDR
SLIWNSDLIETMELENLLVNACITMHSAEARKESRGAHAREDFTKRDDVNWMKHTLGYWE
EGNVKLEYRPVHMNTLDDEVDTFPPKARVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgccttcgagtagcgtcgtcgaggagatcggaatctaatggcgctttcgtc
acgtctcaactctccagattcttctcaactccttcgacaggggatagatcatcgtatacg
atcgtggatcatacctatgatgcggttgttgtaggagctggtggtgctgggcttagagca
gcaataggtttatcagaacatggttttaacacagcttgtatcaccaagctttttccaact
cgttctcatacagttgcagctcagggaggtataaatgctgccttgggtaatatgactgaa
gatgactggagatggcatatgtatgatactgtcaaaggaagtgactggttaggtgatcaa
gatgcaattcagtttatgtgcagggaggctccaaaagctgtgattgagcttgagaattat
ggattaccattttctagaacagaagatggcaaaatatatcaacgagctttcggtggccag
agtcttgattttggaaaaggtggtcaagcataccgctgctcatgtgcggctgaccgcacc
gggcatgctctgttacatactctttatggacaagcaatgaaacacaacactcaattcttt
gtggaatactttgccttggatttgataatgaacagtgatggaacctgtcaaggagtcatt
gcactgaacatggaagatggaactttacatcgtttccatgctggttctacaattttagct
actgggggctatggaagagcttatttttctgcaacttcagcacatacatgcacaggagat
ggcaatgctatggttgcacgggccgggctaccgttacaggacttggagtttgttcagttt
catcctactggtatatatggagctggatgtctaatcacagaaggagctagaggtgaaggt
gggattctaagaaacagtgaaggagagaaattcatggacaggtatgctcccacggctaga
gatcttgcttcaagagatgttgtttcaagatcaatgactatggaaatccgacaaggacgt
ggtgcaggacctatgaaggatcatatatatcttcacttaaaccatctaccatcagaggtg
cttaaagaaaggcttcctggcatatctgagactgcggctatttttgcgggtgttgatgtt
acaagagagccaattcctgtattgcctactgtgcattataatatgggtggtattcccaca
aactaccatggagaggttgttaccgttagaggtgatgatacagatgctatagttcctgga
ctaatggctgcaggagaagcagcttgtgcatcggttcatggcgctaatagacttggcgca
aattcacttcttgacattgttgtttttgggagagcttgtgcaaacagagttgcagagatt
caaaaacctggcgagatactgaaacctctagagaaggatgcgggtgagaagagtatcaaa
tggttggaccggataagaaactcaaatggttcgcttccaacttctaaaatccgtttaaac
atgcaacgagtaatgcaaaacaatgctgctgtcttccgtacacaagaaacactagaagaa
ggttgtgatttgatggacaagacgtgggacagttttggtgatgtcaaagtgacagatcgg
agtttgatatggaactcggatttgatagaaactatggagttggagaatcttttggttaat
gcatgcataacaatgcattctgctgaggctaggaaggagagtcgaggagcacatgctcgt
gaggatttcacgaaacgagacgatgtgaattggatgaagcacacattggggtattgggaa
gaagggaatgtgaaactggagtacagaccagtgcacatgaatacattggatgatgaggtt
gacacttttcctcctaaagctcgtgtttactga

DBGET integrated database retrieval system