KEGG   Camelina sativa (false flax): 104708088Help
Entry
104708088         CDS       T05044                                 

Definition
(RefSeq) uncharacterized protein LOC104708088
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00061  Fatty acid biosynthesis
csat00780  Biotin metabolism
csat01100  Metabolic pathways
csat01212  Fatty acid metabolism
Module
csat_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    104708088
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    104708088
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:csat01004]
    104708088
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     104708088
Lipid biosynthesis proteins [BR:csat01004]
 Fatty acid synthase
  Component type
   104708088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 104708088
NCBI-ProteinID: XP_010422883
LinkDB All DBs
Position
8
AA seq 220 aa AA seqDB search
MAASSSVFTASSSRNLATIPLHQSLSPPLLRSSSVAFRPKRRSSSLVLCSTDESKSTAEE
KEIPIELRYEAFPTVMDINKIQEILPHRFPFLLVDRVIEYTAGVSAVAIKNVTINDNFFP
GHFPERPIMPGVLMVEAMAQVGGIVMLQPEVGGSKSNFFFAGIDKVRFRKPVIAGDTLVM
RMTLVKLQKRFGIAKMEGKAYVGNSLVCEGEFLMAMGKEE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttccagctccgttttcacagcatcctcgtcgcgaaacctcgcgactatccct
cttcatcagtcactatctccaccgttgctcagatcgagctccgtcgcgtttcgtcccaaa
cgccgatccagctcgctcgtcttgtgctccactgatgaatcaaagagcaccgcagaggag
aaagagatcccaattgaactcagatatgaggcatttccaacggtgatggacatcaacaag
atacaagagattttgcctcacagattcccgtttctgttagtggatagagtgatagagtac
acggctggtgtatctgcggtagctattaaaaacgttacaattaatgataatttctttcct
gggcatttccctgagaggcctataatgcctggagtcctcatggttgaggccatggctcag
gtgggaggtatagtgatgctacaaccagaagttggtggatcgaaaagcaacttcttcttt
gctggaatcgacaaagtcaggttcagaaagcctgtgattgcaggtgatactcttgtgatg
agaatgacgcttgtgaagttgcagaagcggtttgggatagcgaaaatggaagggaaagca
tatgtagggaactctttggtatgtgaaggagagttcttgatggctatgggaaaagaagag
tga

DBGET integrated database retrieval system