KEGG   Camelina sativa (false flax): 104708982Help
Entry
104708982         CDS       T05044                                 

Definition
(RefSeq) transcription factor bHLH140-like isoform X2
  KO
K10863  aprataxin [EC:3.1.11.7 3.1.11.8 3.1.12.2]
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:csat03400]
    104708982
Enzymes [BR:csat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.7  adenosine-5'-diphospho-5'-[DNA] diphosphatase
     104708982
    3.1.11.8  guanosine-5'-diphospho-5'-[DNA] diphosphatase
     104708982
   3.1.12  Exodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.12.2  DNA-3'-diphospho-5'-guanosine diphosphatase
     104708982
DNA repair and recombination proteins [BR:csat03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     104708982
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     104708982
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DcpS_C AAA_33 HIT Macro zf-C2HE AAA_18 AAA_29 AAA AAA_16 AAA_19 AAA_22 AAA_17 AAA_24 ATP_bind_1 RNA_helicase AAA_5 ABC_tran DM
Motif
Other DBs
NCBI-GeneID: 104708982
NCBI-ProteinID: XP_010423943
LinkDB All DBs
Position
8
AA seq 692 aa AA seqDB search
MEDSEKTNQIVVLLIGPPGSGKSTFCDTVMRSSLRPWSRVCQDIINNGKAGTKAQCLKMA
TSSLKEGKSVFIDRCNLDREQRSEFVKLGGPGIEVHAVVLELPAQVCISRSVKRTGHEGN
LQGGRAAAVVNRMLQSKELPKVNEGFSRVMFCYNDADVENAVNTYSKLGPMDTLPSGCFG
EKKSDTKSQPGIMKFFKKVNALPGSSSSNEGTNAMRKANEKTENFRLGSADIVHTLAFPS
VSTADFQFDLEKASDIIVEKAEEFLPKVGTARLVLVDLSHGSKILSLVKAKASQKNIDSE
RFFTFVGDITKLRSEGGLHCNVIANATNWRLKPGGGGVNAAIFKAAGPDLETATRVRANT
LLPGKAVVVPLPSTCPLLNAEGITHVIHVLGPNMNPNRPDNLSNDYTKGCKTLREAYTSL
FEGFLSVVQDQSKFPKRSNQTAVSDSGEHIKEDSERNKKYKGSQDKAVTNNMESGSLEDT
RDSGKKMSKEWSTWALALHTIAMHPERHENVVLEFSDNIVVINDQYPKARKHVLVLARQE
SLDGLEDVRKENLQLLQEMHNVGLKWVDRFQNEDASLIFRLGYHSVPSMRQLHLHVISQD
FDSDSLKNKKHWNSFTSSFFRDSVDVLEEVKSQGKANVASEDLLKGELRCNRCRSAHPNI
PKLKSHVRSCRSQFPEHVLQNSRLVARPETKL
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggaagactctgagaagacgaatcagatagtggtgcttctgattggtccgccaggaagc
ggcaaatcgacgttttgtgacaccgtgatgcgttcctctctccgcccttggtctcgcgtc
tgtcaggacattattaacaatggcaaagctggaacaaaggctcagtgtttaaagatggca
acaagttccctcaaggaaggcaagagcgtttttatagacagatgcaatcttgacagagag
cagcggtctgagtttgttaagcttggtggtcctggcattgaagtccatgcagtcgttctg
gagcttcctgctcaggtttgtatttctagatcagtcaaaagaaccggtcatgaagggaat
ctacaaggcggtagagctgcagctgttgtgaataggatgcttcagagtaaggaactaccc
aaagtgaatgaagggttttctcgggttatgttttgttacaacgatgctgatgttgagaat
gctgttaacacatacagcaagcttggtccaatggatactcttccttctggctgttttggc
gaaaagaaatcagacactaaaagccaacctggtataatgaagttctttaagaaagtcaat
gctcttcctggttcatcatcttctaatgaaggtactaatgcaatgcgcaaagctaatgaa
aagacagaaaatttccgacttggttctgctgatattgtacatacactggcattcccatca
gtttcgactgctgattttcagtttgatcttgaaaaggcttctgatatcattgtcgagaaa
gcagaggaattcttgcccaaagttgggactgcgcgtcttgtcttggtggacttgagccac
gggtcaaagattctgtctcttgtcaaagctaaggcttctcagaagaacattgactcagag
agatttttcacatttgtcggggacataactaagcttcgttctgaaggtggtttacactgc
aatgttatagctaatgctactaattggcggcttaaacctggaggtgggggtgtgaatgca
gcaatattcaaagctgctggtccagatctcgagactgcgacaagagtacgagcaaacact
cttcttcctggaaaagcagtggtagttcctcttccttctacttgccctttactcaatgca
gaaggtattacacatgtcatacatgttctaggaccaaacatgaacccaaaccgaccagac
aaccttagcaacgactacaccaagggctgcaaaactctccgggaggcttacacatccctg
tttgaaggttttctatcagtagtacaagatcaatcaaagtttcccaaacgaagcaatcaa
acagctgtgtcagattctggtgagcatattaaggaagactctgagagaaacaaaaagtac
aaaggatcacaagataaggccgtaactaataatatggaatcagggtctctggaggataca
agagacagtggaaagaagatgagtaaagaatggagcacatgggcattggctctccacacc
atcgcaatgcacccagagagacacgagaatgtcgtgctagaattttcagacaacatcgtt
gtgataaacgaccagtacccaaaggctcggaagcatgtgctagtactggcgagacaggag
agtctagatgggctagaagacgttcgcaaggagaaccttcaacttctgcaggaaatgcac
aatgttggtctgaaatgggttgatagattccaaaacgaggatgcatctcttatcttccgc
cttggatatcactcggttccgtcgatgcgacaactacatttacacgttataagccaagac
tttgattcagatagtttaaagaacaagaaacactggaactctttcacgtcctcgttcttt
cgtgactcagttgatgtacttgaagaggtcaagagccaaggtaaggccaatgtggcgagc
gaagatctgttgaaaggggagttgcgttgcaatcggtgtagaagcgcacacccaaatatt
cctaaactcaaatctcatgtcagaagctgccgttctcagtttcctgaacatgtactccaa
aacagtcgccttgtggctcgaccagagactaagctataa

DBGET integrated database retrieval system