KEGG   Camelina sativa (false flax): 104710824Help
Entry
104710824         CDS       T05044                                 

Definition
(RefSeq) actin-related protein 6-like isoform X1
  KO
K11662  actin-related protein 6
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csat03036]
    104710824
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:csat04812]
    104710824
Chromosome and associated proteins [BR:csat03036]
 Eukaryotic type
  Chromatin remodeling factors
   SRCAP complex
    104710824
   SWR1 complex
    104710824
Cytoskeleton proteins [BR:csat04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     104710824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 104710824
NCBI-ProteinID: XP_010425786
LinkDB All DBs
Position
9
AA seq 423 aa AA seqDB search
MSNIVVLDNGGGLIKAGQGGERDPTTVIPNCLYKPLSSKKFLHTSPLTTLSDEIDLTSAS
VRRPIDRGYLINSDLERDIWSHLFTSLLHISPSSSSLLLTEPPLSIPSVQRSTDELVFED
FGFSSLYVAHPQSLVHLYEASRQPDSVLSKTQCSLVVDCGFSFTHAVPVLHNFTLNHAIK
RIDLGGKAFTNYFKELVSYRSINVMDETFLVDDAKEKLCFVSLDLLRDLRLARSGNNLIK
STYVLPDGVTHTKGYVKDPQAAKRFLSLSDKDHVESDFMAKVGDRKKADMNKNEIDLTNE
RFLVPETLFQPADIGINQAGLAECIVRAVSSCHSYLQPVLYQSIILAGGSTLFPQLKERL
EVELRPLVPEHFDVKITTLEDPILGVWRGGSLLASSPDFESMCVTKADYEELGSARCRRR
FFH
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacatcgtggttctagacaacggcggcggtctaatcaaagctggacaaggtggg
gagcgtgatcccaccaccgtaatcccaaactgtctctacaaacctctctcatcgaagaaa
ttccttcacacttcaccactcactactctctccgacgagatcgacctcacctccgcctct
gtacgccgccccatcgaccgtggctacctcataaactctgacctagaacgcgacatctgg
tcacacctcttcacctctctcctccacatcagtccttcctcctcctctctcctcctcact
gagccaccactctcgatcccttccgttcagcgttccaccgacgagcttgtcttcgaggac
ttcggattctcgtctctctacgtagctcatcctcagtctcttgttcatctctatgaagct
agtcgtcagcctgattcagtcctctcaaagactcagtgtagtctcgttgttgattgtggc
ttctccttcactcacgctgttcctgttcttcacaatttcactcttaatcacgccattaag
aggattgatttaggaggcaaagctttcactaattactttaaggaattggtctcttataga
tctataaatgttatggatgaaacctttttagttgatgatgctaaggagaagctttgtttt
gtctcacttgaccttcttcgtgatctccgccttgctagaagtggaaataatcttatcaag
tctacatatgttcttcctgatggtgttacacatactaaaggttatgtcaaagaccctcaa
gcggctaagaggtttcttagcttgtcagataaagatcatgtggagtctgatttcatggca
aaggttggggacaggaagaaggctgacatgaacaaaaatgagattgacttaacgaatgag
cgctttcttgtacctgagacgctattccagcctgcggatatagggataaatcaggcagga
cttgcagagtgcatcgtccgagctgtaagctcatgtcattcttatttgcaaccagtcttg
tatcaaagcatcatcttagctggtggaagcacattatttccgcaacttaaggagagactg
gaagtagagcttcgaccactagtcccagagcactttgatgtgaagataacaacactggag
gacccaatactaggcgtatggagagggggttcacttttggcttccagcccggattttgag
tccatgtgtgtcaccaaggctgactatgaagaacttggatcagctcgttgtcggaggaga
ttctttcattga

DBGET integrated database retrieval system