KEGG   Camelina sativa (false flax): 104713782Help
Entry
104713782         CDS       T05044                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104713782
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csat03036]
    104713782
Enzymes [BR:csat01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104713782
Chromosome and associated proteins [BR:csat03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104713782
   Polycomb group proteins
    PRC2-EZH2 complex
     104713782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET TCR
Motif
Other DBs
NCBI-GeneID: 104713782
NCBI-ProteinID: XP_010429288
LinkDB All DBs
Position
9
AA seq 906 aa AA seqDB search
MASGASPSSSATRSEPPKESTPEERSPASKEVSAVIESLKKKLAADRCVSIKKRFDENKK
NLCGITQSFMRSSMERGGSCKDGNDLLVKRQRDSPGMKSGIDASDGDRNNHRFVDDGHAN
SAIFQGSSVPVKISLRPIKLPDIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGG
EALICSDSEEEVIDDEEEKREFLEPEDFIIRMTLEQLGLSDSVLEELANLLSRRSSEIKA
RHGVLMKEKEISESGDNQAESSLLNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIFP
AEKPAPWCPPVDENLTCGANCYKTLLKSERIPGYGTTENKTGTSSDCAGTKTTSTKLSSK
LSRRKPKTFPSESASSNEKCTPETSDSENGLQQDTNSDKVSSSPKVKGSGRRGGRKRINN
RVAERVPRRTQKRQKKTEASDSDSIASGSRSPSDAKLKENEDATSSSQKHVKSGNSGKSK
KNGTPAEDSKNSVKDDDPVCQLNEVASELDAPCSDESLRKEEFVGENACRRGLATNKLWR
PLEKSLFEKGVEIFGMNSCLIARNLLSGFKSCWEVFQYMTCSENKASFFGEDALNPDGSS
KFDINGNMANNQVRRRSRFLRRRGKVRRLKYTWKSAAYHSIRKRITERKDQPCRQFNPCN
CKTACGKECSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDV
CRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGWGAFLKNSVSKHE
YLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPEPNCY
AKVIMVAGDHRVGIFAKERIMAGEELFYDYRYEPDRAPAWAKKPEAPGSKKDEHVTPSVG
RPKKLA
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgggagcttcgccttcttcttcggcgaccagatcggagccacctaaggagtct
acgccggaggagagaagtccagcttctaaggaagtgtcagcagtaatagaatcactaaag
aagaaacttgcagctgatcgttgtgtatcaattaagaaaaggtttgatgaaaacaagaag
aatttgtgtggcattactcaaagctttatgaggtcttctatggagagaggaggtagctgt
aaagatggtaatgatcttttagttaagaggcaaagagattcgcctggtatgaaaagcgga
atcgatgctagtgatggtgataggaataaccacagattcgttgatgatggacatgccaat
tcagcgatatttcaaggatctagtgtccctgttaaaatttccttacggccaatcaaacta
cctgatatcaaacgtttgtcaccttataccacatgggttttcctggacaggaatcaaaga
atgactgaagaccagtctgttgtgggtcgaaggagaatttattatgatcaaactggcggg
gaagcgctcatttgcagtgatagtgaagaggaggtgattgatgacgaagaagaaaaaaga
gaatttttggagcctgaagattttattattcgcatgacccttgagcaactaggtctttca
gactctgtcttggaggaactagcaaatctcttgtccagacgttctagtgaaatcaaggca
agacatggagtgcttatgaaggaaaaagaaatatccgagagtggagataatcaagcagag
agctcccttctcaacaaagatatggaaggagcattagattctttcgataacctgttctgc
cgtagatgccttgtatttgattgccggctgcatgggtgttcacaggatcttatttttcct
gctgagaaaccagcgccgtggtgtcctcctgtagatgaaaatctaacctgtggtgcaaac
tgctataaaacgcttctgaagtctgaaagaattccgggatatggcaccaccgaaaataaa
actggcacttcatcagattgtgcgggtactaagaccacatccacgaagttatccagcaaa
cttagtaggagaaaaccaaagaccttcccaagtgaaagtgcatcgtctaatgaaaagtgc
acaccagagacaagtgactcagagaatggacttcagcaggataccaattccgataaagtt
tcatcatcaccaaaagtgaaaggtagtgggagacgtggaggtcgtaagaggattaataac
cgagtcgctgagcgagttcctcgtaggactcagaagaggcaaaagaagacagaagcctca
gacagcgattccatcgccagtggaagtcgttcacccagcgatgcaaaacttaaagaaaat
gaagatgctacttcctcttctcagaagcatgttaaatctgggaactccgggaagtcaaag
aagaatggcacccctgcagaagactctaagaattctgtcaaggatgacgatcctgtttgt
cagttaaatgaggttgcttctgagcttgatgcgccatgtagcgatgaaagtttacggaaa
gaagagtttgttggtgagaatgcatgtcgaagaggattggctacaaacaagttgtggaga
ccacttgagaaaagcctttttgaaaaaggtgttgagatttttggaatgaatagctgctta
attgctagaaaccttttgagtggtttcaagtcatgttgggaggtcttccaatacatgact
tgctcggaaaataaagcttccttctttggagaggatgcattaaaccccgatggctcttcc
aagtttgacatcaatggaaatatggcaaataaccaagtgaggagaaggtcaaggtttcta
cgtagacgaggcaaagtgcgtcgcttgaagtatacatggaaatctgctgcatatcattca
attaggaaaagaattactgagaggaaagaccagccatgccgtcaatttaatccatgcaac
tgcaaaactgcttgtgggaaggaatgttcttgtttactaaacgggacttgctgcgagaag
tactgcggttgcccaaagagctgcaagaataggtttagaggttgtcattgtgcaaaaagt
cagtgtcgaagccgtcagtgtccatgctttgctgcagatcgggaatgtgatccagatgtt
tgtaggaactgctgggtcattggcggggatggtacgctcggggtgccaagtcaaagaggc
gataattatgagtgcaggaatatgaaattgctcctgaaacaacagcaaagggttttgctt
ggaagatctgatgtttctggttggggagctttcttaaagaacagtgtaagtaaacatgaa
taccttggggaatacacaggagagctgatctcacataaagaagcagataaacgggggaag
atatatgatcgcgagaactcctcttttctcttcaatctaaacgatcagtttgtgctagat
gcttacaggaaaggagacaaactgaaatttgccaaccattctcctgaaccaaactgttac
gcaaaggtcattatggttgctggagatcacagggtggggatttttgcaaaggagaggata
atggctggagaagaactcttctatgattaccggtatgagccagatcgagctcctgcttgg
gccaaaaaacctgaagctccgggttctaagaaagacgaacatgttactccttctgttggt
agacccaagaagcttgcttag

DBGET integrated database retrieval system