KEGG   Camelina sativa (false flax): 104714157Help
Entry
104714157         CDS       T05044                                 

Definition
(RefSeq) anaphase-promoting complex subunit 6-like
  KO
K03353  anaphase-promoting complex subunit 6
Organism
csat  Camelina sativa (false flax)
Pathway
csat04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104714157
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csat01009]
    104714157
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:csat04121]
    104714157
   03036 Chromosome and associated proteins [BR:csat03036]
    104714157
Protein phosphatases and associated proteins [BR:csat01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104714157
Ubiquitin system [BR:csat04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     104714157
Chromosome and associated proteins [BR:csat03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    104714157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_8 TPR_12 ANAPC3 TPR_10 TPR_7 TPR_16 TPR_11 TPR_19 TPR_3 SRP_TPR_like Sel1
Motif
Other DBs
NCBI-GeneID: 104714157
NCBI-ProteinID: XP_010429718
LinkDB All DBs
Position
9
AA seq 545 aa AA seqDB search
MREEEIEKIRGVVRDCVSKHLYSSAIFFADKVAALTNDPADIYMQAQALFLGRHYRRAFH
LLNASKIVLRDLRFRYLAAKCLEELKEWDQCLLMLGDAKVDEDGIVYDAKDGNVIDFDKD
AEDREINISSAICFLRGKAYGALQNRSQARQWYKAAIKADPLCYEALECLIESHMLTSEE
ESSLLSSLQFSPEDGWLSSFYSCLIKKYDIQSTIDAKFKKLENESGSVSGSSMITLANNT
DRLACKAQYYHQCCEYQKCFELTSALLEKDPFHLKCTLVHLAAAMELGNSNELYLMACNL
VKDYPSKALSWFAVGCYYYCIKKYAEARRYFSKATSIDGSFSPAWIGYGNSFASQEEGDQ
AMSAYRTAARLFPGCHLPTLYIGMEYMRTHSYKLADQFFMQAKAICPSDPLVYNELGVVA
YHMKEYSEAVRWFKKTLSHIPSALTETWEPTVVNLAHAYRKLRKYPEAISYYEKALTLST
KSLSTYSGLAYTYHLQGKFSAAISYYHKALWLKADDQFCTEMLNVALMDECQTGVESVDA
KVEPC
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgagggaagaagaaattgagaagatccgcggcgtggttcgagactgcgtaagtaagcat
ttgtactcgtcggccattttcttcgccgacaaagtagcggcactcaccaatgacccagct
gacatttatatgcaagctcaagctctttttctcggtcgccattaccgacgcgcctttcac
cttctcaacgcctctaagattgtcctccgagatcttcgattccgttacctcgccgccaag
tgcctcgaggaattgaaggaatgggatcagtgtctcttgatgcttggtgatgctaaggtt
gatgaagatggaattgtctatgatgccaaagatggtaacgtcatagattttgataaagat
gcagaggaccgagagattaatatttcatcggcaatatgctttctaagagggaaagcatat
ggagctttacaaaaccgttctcaggctcgacaatggtacaaagctgctatcaaggctgat
cctctgtgctatgaggctttggaatgccttattgaaagtcatatgcttacatctgaagaa
gaatcgagtctgctttcttcactgcaatttagtccagaagacggatggctctcgtctttc
tattcatgcttgataaagaagtatgacatacagagcacgatagatgctaagttcaagaag
cttgagaacgaaagtggtagtgtctctggatcatcgatgatcacattggctaataacact
gatcggttggcctgtaaagctcagtactaccatcaatgctgtgaatatcagaagtgtttc
gaactaacctctgcactccttgaaaaagatccttttcatttgaagtgtaccttggtacat
ttggccgctgccatggaacttggtaattcaaatgagctctatctaatggcatgcaatttg
gtaaaagactacccttcaaaggcgttgtcatggtttgcggtgggttgttactactattgt
atcaaaaagtatgctgaagctcggcggtactttagtaaagctacgagtatagatggctca
ttctcaccagcttggataggttatggtaattcctttgcttcccaagaggagggtgaccaa
gccatgtctgcctatcgtactgccgctaggctatttccagggtgtcatttgccaactctg
tacattggaatggagtatatgcgaactcacagctacaagcttgcggaccagtttttcatg
caagctaaggcgatatgcccttcggatccacttgtttacaatgaactcggagttgttgca
tatcatatgaaagagtatagtgaagctgtgcggtggtttaagaagacattgtcccatata
ccatctgcattaactgaaacatgggaaccaactgtggtcaatctcgctcatgcatataga
aagctaagaaaataccctgaagctatctcatattatgagaaagcacttacactatcaact
aaaagcttaagcacttattctggcttggcgtacacttaccatttgcaggggaaattttcc
gctgccatctcatattatcacaaggccttgtggttgaaagctgatgatcaattttgtacc
gaaatgttgaacgtagctctcatggatgaatgtcagactggggttgaatcggttgatgca
aaggttgagccctgctag

DBGET integrated database retrieval system