KEGG   Camelina sativa (false flax): 104716804Help
Entry
104716804         CDS       T05044                                 

Definition
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00400  Phenylalanine, tyrosine and tryptophan biosynthesis
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01230  Biosynthesis of amino acids
Module
csat_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    104716804
Enzymes [BR:csat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     104716804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAHP_synth_2 GTA_TIM
Motif
Other DBs
NCBI-GeneID: 104716804
NCBI-ProteinID: XP_010432550
LinkDB All DBs
Position
10
AA seq 508 aa AA seqDB search
MVTLNASSPLTTKSFLPYRHAPRRPISFSPVFAVHSTDPKKSSNQSASASAKWSLDSWKS
MKALQLPEYPDQKDLESVIQTLSSFPPIVFAGEARKLEEKLGLAAMGQAFMLQGGDCAES
FKEFNANNIRDTFRVLLQMGVVLMFGGQLPVFKVGRMAGQFAKPRSDPFEEKDGVKLPSY
RGDNINGDAFDEKSRIPDPHRMVRAYTQSVATLNLLRAFATGGYAAMQRVSQWNLDFTQH
SEQGDRYRELANRVDEALGFMGAAGLTNAHPIMTTTEFWTSHECLLLPYEQALTREDSTS
GLYYDCSAHMVWVGERTRQLDGAHVEFLRGIANPLGIKVSDKMVPSELVKLIEILNPQNK
PGRITVIVRMGAENMRVKLPHLIRAVRGAGQIVTWVSDPMHGNTIMAPSGLKTRSFDAIR
AELRAFFDVHDQEGSFPGGVHLEMTGQNVTECVGGSRTITYNDLSSRYHTHCDPRLNASQ
SLELAFIIAERLRKRRLGSGNHLSSIGV
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggtgactctaaacgcgtcttctcctctcacgacgaagtcgttcttaccttaccgacac
gctcctcgccgtccgatctctttctcccctgttttcgcggttcattcgactgaccccaag
aaatctagcaaccaatcagcctctgcctcggctaaatggagtctagacagttggaaatcg
atgaaagctttgcaattgccggagtatccagatcagaaggatctcgaatcggttatacag
acgctttcgtcttttcctcctatagtattcgctggtgaggcgaggaaactggaggagaag
cttggactagcggctatgggtcaggcctttatgctccaaggtggtgattgtgctgagagt
ttcaaggagttcaacgctaataacattagagatacctttagggttcttcttcagatgggt
gttgttctcatgttcggtggccagttgccagttttcaaggtgggaagaatggctggtcag
tttgcgaagccgagatcagatccattcgaggagaaagatggcgtcaagctgccgagttac
agaggtgataacataaacggtgatgcttttgatgagaaatcgaggatccctgatcctcat
aggatggttagagcgtatacacaatctgtggctacgttgaatctattgagagcatttgca
actggaggttatgcagctatgcagagagttagccagtggaatcttgatttcacccagcat
agtgaacagggtgacaggtaccgtgaattggccaatagagttgatgaggctttaggattc
atgggtgcagctggacttaccaatgctcacccaatcatgactactactgagttttggaca
tcccacgagtgcttactgttgccttatgagcaagcgctcactagagaagattcaacatcc
gggctttactatgattgttctgcgcacatggtttgggttggagaacgaactcgccaactt
gatggtgctcatgttgagtttctgaggggaatagctaaccctcttggaatcaaggtgagt
gataaaatggtccctagtgaactggttaagctgatagagatactaaaccctcagaacaag
cctggaaggattacagttatagtgagaatgggagctgagaatatgcgtgttaagcttcct
cacttgatcagagcagtacgtggagctggtcagattgtgacttgggttagtgatccaatg
cacggaaacacaatcatggctccaagtgggctaaaaactcgttctttcgatgcaatcagg
gcggaactgagagcgttctttgacgtgcatgatcaagaagggagtttccctggtggggtt
catttggaaatgaccggacaaaacgtgacagaatgtgtcggagggtcacgcaccatcact
tacaacgacctaagctcgcgttaccacactcactgtgacccaaggctcaacgcttctcag
tctcttgagcttgcgttcatcattgcagagcgtctgcgaaaaagaaggctcggttccgga
aaccacctatcatctattggagtctag

DBGET integrated database retrieval system