KEGG   Camelina sativa (false flax): 104722328Help
Entry
104722328         CDS       T05044                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 3
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00010  Glycolysis / Gluconeogenesis
csat00030  Pentose phosphate pathway
csat00051  Fructose and mannose metabolism
csat00052  Galactose metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01200  Carbon metabolism
csat01230  Biosynthesis of amino acids
csat03018  RNA degradation
Module
csat_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104722328
   00030 Pentose phosphate pathway
    104722328
   00051 Fructose and mannose metabolism
    104722328
   00052 Galactose metabolism
    104722328
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    104722328
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csat01009]
    104722328
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:csat03019]
    104722328
Enzymes [BR:csat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     104722328
Protein phosphatases and associated proteins [BR:csat01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104722328
Messenger RNA biogenesis [BR:csat03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     104722328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase HHH_2
Motif
Other DBs
NCBI-GeneID: 104722328
NCBI-ProteinID: XP_010438777
LinkDB All DBs
Position
11
AA seq 486 aa AA seqDB search
MSTVESSKPKIVEGSCGYVLQDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSV
PQKIVVHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYM
YGVKRILGIDGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRG
INQVYIIGGDGTQRGASVIFEEIRRRGLKVAVIGIPKTIDNDIPVIDKSFGFDTAVEEAQ
RAINAAHVEAESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLF
EYIEKRLKESGHMVIVIAEGAGQDLMSKSMETLKDASGNKLLKDVGLWLSQSIKDHFNKK
MVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFY
RITETQNHVVITDRMWARLLSSTNQPSFLCPKDVSDNKEKLMSALLDDGNCNGTVDVPPV
TKEITK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgtggagagcagcaaaccgaagatcgtcgaaggttcttgtggttatgttcta
caagacgttcctcatctctctgattaccttcctggtcttcctacttatcctaatccattg
caagacaatccagcatactctgtggtaaagcaatactttgttgatgctgatgacagtgtt
cctcaaaagattgttgttcataaggatggaccaaggggaattcattttagacgagccggg
ccacgtcaaaaggtgtactttgaatctgatgaagtgcatgcttgcatagttacctgtggg
ggtctttgtcccggccttaataccgtgattagagaaatagtgagcagtctatcttacatg
tatggagtgaagagaatactgggaatagatggaggatatagaggcttttatgctaagaat
actgtctccttagactctaaagttgtaaatgatatccataagcgcggaggtactatcctt
gggacctcacgagggggtcacgataccacaaagatagttgacagcattcaagatcgagga
atcaatcaggtttacattataggaggagatggaacacagcgaggagcatcagttatattt
gaggaaataagacgacgtggactgaaagttgcagtcattggaatcccgaaaacaatcgat
aatgacatacctgtgatagacaaatcttttgggtttgacacagctgtagaagaggctcaa
cgagctattaacgcagcacatgtggaagccgagagtatagagaatggtattggcgttgtc
aagcttatgggtcgctacagcgggttcatagcgatgtacgctactctagcaagtagagat
gtggactgttgtttgattccggagtcaccattttacctagaaggagaaggcggattgttt
gagtacatagagaaacggctcaaggagagcggtcacatggtgattgtgattgcagaaggt
gcaggacaagatctaatgtcgaagagcatggaaacactcaaggatgcatctggtaataaa
cttctgaaagatgttggtctttggctgtcacagagcatcaaggatcattttaataagaag
atggtgatgaacctcaagtacattgatccaacatacatgattcgagctgttcctagcaat
gcgtcagacaatgtttattgtacacttctggctcagagtgcagtgcacggtgcaatggct
ggatacactggctatattagtggtctagtgaacggaagacaaacctacattcccttctat
agaataacagagacccagaaccatgtggtgatcacagacaggatgtgggcgaggctactc
tcttcgacgaaccagccaagcttcttgtgcccaaaagatgtctctgataacaaagagaaa
ctgatgtcggctcttctggacgatggcaactgcaatggcacggttgatgttcctccagtc
accaaagagatcacaaagtga

DBGET integrated database retrieval system