KEGG   Camelina sativa (false flax): 104725109Help
Entry
104725109         CDS       T05044                                 

Definition
(RefSeq) actin-related protein 9 isoform X1
  KO
K11673  actin-related protein 8
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csat03036]
    104725109
Chromosome and associated proteins [BR:csat03036]
 Eukaryotic type
  Chromatin remodeling factors
   INO80 complex
    104725109
   INO80 complex (yeast)
    104725109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin Actin_micro
Motif
Other DBs
NCBI-GeneID: 104725109
NCBI-ProteinID: XP_010442015
LinkDB All DBs
Position
11
AA seq 592 aa AA seqDB search
MATRKSKSHISLQDYLKSVAPTQILSERGSNLVVINPGSANVRIGLAMDEKPFNVPNCIA
RYHTGKPNVVDQMLNTQVTTNQHVDRERAYNTAASLLKIPYLDESSSGSASRKMGRIDGY
NKPSTTKKDTVFTWTDVYEDVQISPVASETSADKGEASATKAAPDVIDSKDASESKRKYK
KTIFGEEAMKISPKEPYCIRHPIRRGHFNVSPHYSAQQVCEDLTAILDWVLLEKLHISHS
ERFSFHAVLVVPETFDSREIKEMLTVVLGGLRFNSAVVHQEGLSAVFGNGLSTACIVNIG
AQTSTVVCIEDGVSLPNTEKILPFGGEDICRCLLWIQRHYQKWPQIRTDVLAKPIDLLML
NQLKESYCDIREGEVEAGATVHSYEDGMPAMPHKTTLTSLNVPPMGLFYPNLLVPEVFPQ
PPREWFQDYENMLEDTWNMDFGGGGNMGLPMWDSFAVSPSKPKKEEKIGLAEAITSSILS
AGRIDLRRKLFSSIQLIGGVGSTKGLVPAVEERVLRAIPPTEAIKTVEVLPSRTDPAFVT
WKGGAILGILDFGREAWIERQEWMENGIHKGSTKKYKDSFYIEGQAMYFINP
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccgaaaatcaaaatctcacatctcgttgcaggattacttgaaatctgttgcc
ccgactcagattttatccgaacgaggatcaaatctcgttgtcatcaacccaggctctgcg
aatgtaagaattgggttggctatggatgagaagcctttcaatgtccctaattgtattgct
agataccacacagggaaaccaaatgttgttgatcagatgcttaacactcaggtcacgacg
aatcaacatgttgaccgtgagagagcttacaatacagcggcatcgctgttgaagataccg
tatctggatgaaagttcttctggctctgcatcacgcaagatgggaaggatcgatgggtac
aataaaccgagcactacaaagaaagatacagtctttacttggactgatgtgtatgaggac
gtgcagatttctcctgtcgcgtcagaaacttctgctgataaaggtgaggccagcgcaact
aaagctgctcctgatgttatcgattctaaagatgctagtgagagtaagcgtaagtacaag
aagacgatttttggtgaagaagctatgaaaatatcgccaaaagagccatattgcatacgc
catcctattcggagaggtcacttcaatgtttcgccacattattcagcacagcaggtttgc
gaggacttaaccgctatcttggactgggttctattagaaaaactacatatttctcacagt
gaaagattctcttttcatgctgttcttgttgtcccggaaacatttgacagccgcgaaatt
aaggaaatgttaactgttgtgttgggagggctacgctttaactcagcagttgtccaccaa
gaaggtctatccgctgtttttgggaatggtttgtcaacagcttgtattgtgaatattgga
gcccagactagtacagttgtttgtatcgaggatggagtctcattgccaaatactgaaaag
attttaccttttggaggagaggatatatgtagatgccttctatggattcagcggcattac
caaaagtggccacaaatccgaacagatgttttggcaaagccaatcgatttgctgatgctt
aatcaacttaaggagtcatattgtgatattagagaaggagaagtggaagctggtgcaaca
gttcattcttatgaggacggcatgccagctatgcctcacaaaacaactctcacctcactt
aatgttccgccaatgggtctgttttatcctaaccttttggtccctgaagtgtttcctcag
cctccacgtgaatggttccaagactacgagaatatgttggaggacacgtggaacatggac
tttggaggtggtggtaatatgggattaccaatgtgggatagttttgcagtttccccttcg
aaaccaaagaaagaagagaagattggtctcgctgaagccattacaagcagcatcctctct
gctggacgcatagaccttaggcgaaagcttttctccagcattcaattgattggtggtgtt
ggttcgactaaaggtcttgtaccagctgtggaagaaagagttcttcgcgcaatacctcca
actgaagctatcaagactgtggaggttctgccgtcaagaacggacccagctttcgtaact
tggaaaggcggagcgatattgggaattctggactttggaagagaagcttggattgagcga
caggaatggatggaaaatgggattcataaaggcagtacaaagaagtacaaagactctttt
tacattgaaggtcaagcaatgtacttcatcaacccctag

DBGET integrated database retrieval system