KEGG   Camelina sativa (false flax): 104732002Help
Entry
104732002         CDS       T05044                                 

Definition
(RefSeq) probable enoyl-CoA hydratase 1, peroxisomal
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00071  Fatty acid degradation
csat00280  Valine, leucine and isoleucine degradation
csat00310  Lysine degradation
csat00360  Phenylalanine metabolism
csat00380  Tryptophan metabolism
csat00410  beta-Alanine metabolism
csat00640  Propanoate metabolism
csat00650  Butanoate metabolism
csat00903  Limonene and pinene degradation
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01212  Fatty acid metabolism
Module
csat_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    104732002
   00650 Butanoate metabolism
    104732002
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104732002
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104732002
   00310 Lysine degradation
    104732002
   00360 Phenylalanine metabolism
    104732002
   00380 Tryptophan metabolism
    104732002
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104732002
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    104732002
Enzymes [BR:csat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     104732002
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 104732002
NCBI-ProteinID: XP_010449834
LinkDB All DBs
Position
12
AA seq 265 aa AA seqDB search
MDQTVPENLIMVNKESGGIAVITINRPKSLNSLTRAMMVDLAKAFKDMDSDESVQVVIFT
GSGRSFCSGVDLTAAESVFKGDVKDPETDPVVQMERLRKPIIGAINGFAITAGFELALAC
DILVASRGAKFMDTHARFGIFPSWGLSQKLSRIIGANKAREVSLTSLPLTADVAGKLGFV
NHVVEEGEAFKKAREIAEAIIKNEQGMVLRIKSVINDGLKLDLGHALALEKERAHAYYSG
MTKEQFKKMQEFIAGRGSKKPSSKL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaacagtaccggaaaatctcatcatggtgaacaaagaatcaggcgggatcgcc
gtcatcacaatcaaccgtccgaaatctctcaattcgctcacgagagcgatgatggtggat
ctcgccaaggctttcaaagacatggactccgacgaatcggtccaggtggtgattttcacc
ggatcaggtcgatctttctgctcaggcgttgatttgactgcggcggaatctgttttcaaa
ggagacgtgaaggatccggaaaccgacccggttgtgcagatggaacggttacgtaaaccg
atcatcggagctatcaacggtttcgccatcaccgccgggttcgaactcgccttggcctgt
gatattttggttgcttctagaggagctaagttcatggatactcacgccaggtttgggata
tttccttcatggggtttgtctcagaagctgtcgaggatcattggagcaaacaaagctagg
gaagtttctttaacatcgttgccattaacagctgacgtagctgggaagttagggtttgtg
aaccatgtggttgaagaaggggaagcgttcaagaaagctagagaaatcgcagaggctata
atcaagaatgagcaaggcatggttctgaggattaaatctgttatcaatgatggactaaag
cttgatcttggacatgctctcgcactcgaaaaggagcgagctcacgcgtattacagtggg
atgaccaaggaacagtttaagaagatgcaggagtttatagctggacgtggatccaagaaa
ccttcttccaagttgtag

DBGET integrated database retrieval system