KEGG   Camelina sativa (false flax): 104733001Help
Entry
104733001         CDS       T05044                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain F1, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00630  Glyoxylate and dicarboxylate metabolism
csat00710  Carbon fixation in photosynthetic organisms
csat01100  Metabolic pathways
csat01200  Carbon metabolism
Module
csat_M00165  Reductive pentose phosphate cycle (Calvin cycle)
csat_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
csat_M00532  Photorespiration
csat_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    104733001
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104733001
Enzymes [BR:csat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     104733001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 104733001
NCBI-ProteinID: XP_010450912
LinkDB All DBs
Position
12
AA seq 181 aa AA seqDB search
MASSMLSSAAVVTTPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWP
PIGKKKFETLSYLPDLTDVELGKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGR
YWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKPPSFTG
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctatgctctcctccgctgctgtagttaccaccccagctcaagccaccatg
gtcgctccattcaccggcttgaagtcatccgctgctttccccgtcacccgcaaggcgaac
aacgacattacttccatcgcaagcaatggcggaagagttagctgcatgaaggtgtggcca
ccaattggaaagaagaagtttgagactttatcttacctacctgaccttaccgatgtcgaa
ttgggtaaggaagttgactaccttctccgcaacaagtggattccttgtgttgaattcgag
ttggagcacggatttgtgtaccgtgagcacggaagcacacccggatactacgatggacgg
tactggacaatgtggaagcttccattgttcggatgcactgactccgctcaagtgttgaag
gaagtgcaagagtgcaagaaggagtaccctaacgccttcattaggatcatcggattcgac
aacaaccgtcaagtccaatgcatcagtttcatcgcctacaagcccccaagcttcaccggt
gcttaa

DBGET integrated database retrieval system