KEGG   Camelina sativa (false flax): 104735184Help
Entry
104735184         CDS       T05044                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00052  Galactose metabolism
csat00500  Starch and sucrose metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104735184
   00500 Starch and sucrose metabolism
    104735184
Enzymes [BR:csat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104735184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 TGBp3
Motif
Other DBs
NCBI-GeneID: 104735184
NCBI-ProteinID: XP_010453220
LinkDB All DBs
Position
13
AA seq 911 aa AA seqDB search
MSYLHWFPNIFFVIVVIFSSILASPSHGSSQVVLEGEEATVVGYGYVVRSVAVDSNQKLL
TATLDLIKPSSVYAPDVKTLSLHVSLETSERLRIRITDSSQQRWEIPESVIPRAGNHSPR
RFLTEEVNGGNSPENNFLTDPSSDLVFTLHNTTPFGFSVTRRSSGDVLFDTSPGKSDPNT
YFVFKDQFLQLSSALPGNRSNLYGLGEHTKRSFRLVPGETMTLWNVDVGSENPDVNLYGS
HPFYMDVRGSNGHDEAGTTHGVLLLNSNGMDVKYEGHRITYNVIGGIIDLYVFVGPSPEL
VMNQYTELIGRPAPMPYWSFGFHQCRYGYKNVSELESVVDGYAKARIPLEVMWTDIDYMD
SHKDFTLDPVNFPEDKMKSFVDTLHKSGQKYVLILDPGIGVDSSDGTFNRGMEADVFIKR
DGEPYLGKVWPGKVYFPDFLNPAAATFWSNEIKIFQDILPLDGLWIDMNELSNFITSPPS
PGSSLDDPPYKINNFGNKAPINNNTVPATSIHYGNVSEYNAHNLYGLLEAKATHQALVDV
TGKRPFVLSRSTFVSSGKYTAHWTGDNAAKWEDLAYSIPGILNFGMFGIPMVGADICGFS
HDTTEELCRRWIQLGAFYPFARDHSNLNSVRQELYLWDSVASSARKVLGLRMRLLPHLYT
LMYEAHVGGVPIARPLFFSFPRDTNTYGIDSQFLIGKSILVSPALEQGKVTVDAYFPAGN
WFDLFNFSSVIGGGDSGKHVRLDTPADHVNVHVQEGSIVAMQGEAMTTRDARKTPYQLLV
VASRHENISGELFLDDGESLQMGEGGGNRDWTLVKFRCYITGKSVVLRSEVVNPEYASRM
KWSIEKVKFVGFENVANVKTYEVRTGERLRSPRISLIKTVMDDDDPRFLSVEVSKLSLLV
GKKFEMRLKLT
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatcttcactggtttcccaatatcttcttcgtcattgtcgtcatcttctcctcg
attttagcttcaccctcacatggaagctcacaagttgtactagaaggagaagaagccaca
gtagttggatacggctacgtcgtcagatcagtggccgttgactccaaccagaagcttttg
acggcgactcttgacctgatcaaaccgtcgtccgtttacgcaccagatgttaaaacactt
agccttcatgtcagcttggagacgagtgagcgattgagaatcagaatcacagattctagt
caacaaagatgggagataccggaatccgttattcctcgcgccggaaaccactcacctcgc
cgcttcttaacggaggaagtaaacggaggaaactcgccggagaacaatttcttaacagat
ccatcatcggacttagttttcacactccacaacaccacgccgttcggtttctcagtcacc
cgacgctcctccggcgatgtcctcttcgacacatcgccgggtaaatcagatccaaacact
tacttcgtcttcaaagaccaattccttcaactatcttccgcgttaccgggaaacagatcg
aatctgtacggtctcggagagcacacgaagcgatcgttcaggctagttcccggcgagact
atgactctgtggaacgtcgacgtcggcagcgagaatccggatgttaacctttacggatcg
cacccgttttacatggatgtaagaggttcaaacggtcatgacgaagcagggacgactcac
ggcgttttgttgctgaacagcaatggaatggatgtgaagtatgaaggtcatcggattact
tacaatgtgatcggaggtatcattgacctctatgtgttcgtcggaccatcaccggaattg
gttatgaatcagtacacagagcttattggaagacctgctcctatgccttactggtcattt
ggatttcaccaatgtaggtatggctacaagaatgtttcagagctcgaatctgtagttgat
ggatatgcaaaagctagaatacctcttgaggttatgtggacagacattgattacatggac
agccacaaagacttcactttggatcctgtaaatttcccggaggacaagatgaaatcattt
gtggatacacttcacaagagtggtcagaaatacgtgctgatcttggatcccggtattggt
gtggacagctccgacgggacgtttaatagagggatggaagcagatgttttcataaagcga
gatggtgagccttatctcggtaaggtatggcccggaaaagtatacttccccgacttcttg
aatccagctgctgcaactttttggagcaacgaaatcaagattttccaggacattctccct
ttggatggtctgtggattgacatgaatgagttatcaaatttcataacttcacctccatcc
cctggatcttcactcgatgatcctccttacaagattaacaatttcgggaacaaagcgccg
ataaacaataacacagtacccgcaacatctatccattatggaaacgttagtgaatacaat
gcgcataacttgtatggcctcttggaagctaaagccactcaccaggctttagtggatgta
acgggaaagagaccgtttgttttgtcgagatccacgtttgtaagctcggggaagtacacg
gctcactggacaggtgataatgctgcaaaatgggaggatttggcttactcaatccctgga
attctcaactttggtatgtttggaattcctatggttggagctgatatttgcggtttctca
catgataccaccgaggaactatgtcgtcgatggatccagcttggagctttttaccctttt
gcaagagaccattcgaaccttaattccgtcagacaagaactatacttgtgggattctgtt
gcttcttctgcaagaaaggtgctcggcctccgtatgagactgctcccacatctctacaca
ctgatgtacgaggctcacgttggcggcgtcccaatcgcgcgaccactcttcttctcgttc
cctcgagacactaacacatatgggatcgattcacagttcttgatcggtaaaagcatactg
gtttctccagcgctggagcaagggaaggtgacggtggatgcatatttccccgcaggaaac
tggtttgatctttttaacttttcatctgtcattggtggaggagattctggcaagcacgtt
aggcttgatactcccgcagatcacgtcaacgttcatgttcaagaaggtagtattgtggca
atgcaaggagaggcaatgacaactagagacgccagaaagacaccgtatcagctcctagtt
gtagccagccgacatgagaacatctcgggcgaactgtttctcgatgacggggaaagcctt
cagatgggagagggaggaggaaaccgtgattggactctcgtgaagttccggtgctacata
acgggaaaatccgtggtactaagatcagaagtggtgaacccagagtacgcgtcaagaatg
aaatggagcatcgagaaagtaaaatttgttgggttcgagaacgtagcgaacgtgaaaacg
tacgaggttaggacaggtgagagattgaggagtccaagaatctctctaattaaaacagtt
atggacgatgatgatccaaggtttctgagtgtggaggtttctaaactgtcgctgcttgtt
gggaagaagttcgagatgagattgaaattgacttga

DBGET integrated database retrieval system