KEGG   Camelina sativa (false flax): 104735769Help
Entry
104735769         CDS       T05044                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00250  Alanine, aspartate and glutamate metabolism
csat00410  beta-Alanine metabolism
csat00430  Taurine and hypotaurine metabolism
csat00650  Butanoate metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Module
csat_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104735769
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104735769
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104735769
   00430 Taurine and hypotaurine metabolism
    104735769
Enzymes [BR:csat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104735769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 104735769
NCBI-ProteinID: XP_010453919
LinkDB All DBs
Position
13
AA seq 505 aa AA seqDB search
MVLSHATSDSDGSVHSTFASRYVRTSLPRFKMPENSMPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGETETAIG
VGTVGSSEAIMLAGLAFKRTWQNKRKAEGKPVDKPNIVTGANVQVCWEKFARYFEVELKE
VKLSEGYYVMDPQKAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKENLPEDL
IFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGHEGYTNVMENCRENMIVLKQGLEK
TERFNIVSKDEGVPLVAFSLKDSSCHTEFEISDMLRRYGWIVPAYTMPPDAQHITVLRVV
IREDFSRTLAERLVSDIEKVMHELDELPSRVIQKISLGEEKSEANSDNLMVTVKKSDIDI
QKQRDIIKGWKKFVSDRKNKTNGIC
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctcccatgccacgtcggattcggacggctctgtccactccacattcgcttca
cgatacgtccgaacttcactccctaggttcaagatgcccgaaaactccatgccgaaagaa
gcagcgtatcagatcatcaacgacgagttgatgcttgacggtaacccaaggctaaactta
gcctctttcgtgacgacgtggatggagcctgagtgcgataaactcatcatgtcctccatt
aacaagaactatgttgacatggacgagtaccccgtcaccaccgaactccagaaccgatgt
gtgaacatgattgcacatctattcaatgcaccgttaggagagacggagacagccatcgga
gttggaaccgttggatcatcggaggccataatgttggccggtttggccttcaagcgtaca
tggcagaacaagcgcaaagctgaaggcaaacctgtcgataaacccaacattgtcactgga
gccaatgttcaagtgtgctgggagaaattcgctaggtactttgaggttgagctcaaggaa
gtgaaattgagtgaaggatactatgtgatggacccgcaaaaagctgttgacatggttgac
gagaacactatttgtgttgcggccattcttggttccactcttaatggagagttcgaagat
gttaaactcttgaacgatcttttggtagagaaaaacaaagaaaccggttgggacacaccc
attcacgtggatgcggcaagtggaggattcatagcaccgtttttgtatccggagttggaa
tgggactttagactgccgctggtgaagagtatcaatgtgagtggtcacaagtatggactc
gtgtacgcaggaattggttgggtgatttggagaaacaaagagaatttgcctgaggatctc
atcttccatatcaattaccttggtgctgaccaacccacgttcactctcaatttctccaaa
ggttctagtcaaatcatagctcaatactaccaacttatccgattgggtcacgagggttac
acaaatgtgatggagaattgcagagagaatatgatcgtgctaaagcaaggactcgagaag
acagagaggttcaacattgtttcgaaggacgagggagtgccacttgtcgctttctccttg
aaagatagcagctgtcacactgagttcgaaatttccgacatgcttcgcaggtatggatgg
atagtacctgcctatacaatgcctccagatgcacaacacataactgttcttcgagtggtt
atcagagaagatttctctagaacactcgctgagagactagtgagcgatattgagaaagtg
atgcatgagctcgatgagcttccttcgcgagtgatccaaaaaatatcacttggggaagag
aagagtgaagctaacagcgacaacttgatggtgacggttaagaagagcgatatcgatatc
cagaagcagagagacatcatcaaaggctggaagaagtttgtctctgacaggaagaataag
acgaatggtatctgttaa

DBGET integrated database retrieval system