KEGG   Camelina sativa (false flax): 104739111Help
Entry
104739111         CDS       T05044                                 

Definition
(RefSeq) thymidine kinase a isoform X1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00240  Pyrimidine metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    104739111
Enzymes [BR:csat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     104739111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14
Motif
Other DBs
NCBI-GeneID: 104739111
NCBI-ProteinID: XP_010457697
LinkDB All DBs
Position
1
AA seq 239 aa AA seqDB search
MATLKASILLKTLDSDIVGDVLSDQGRRGSGSIHVIMGPMFSGKSTSLLRRIKSEISDGS
RSVAMLKSSKDTRYAKDSVVTHDGIGFPCWALPDLMSFPDKFGLDAYNKLDVIGIDEAQF
FGDLYEFCCKAADDDGKTVIVAGLDGDYLRRSFGAVLDVIPIADSVTKLTARCEVCGQKA
FFTLRKTCDTRTELIGGADVYMPVCRKHYITNHIVMKASKKVLEDADKARAESCVAVII
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccctcaaagcttcgattttgctcaaaaccctcgacagtgacatcgtcggagat
gttttatccgatcaggggcgtcgcgggtccggttctattcacgttatcatgggtcctatg
ttttctgggaaatcgacctctcttctccgccgaatcaagtcagagatcagtgacggaagc
agaagtgttgcgatgctgaaatcgagtaaagatacgagatacgccaaagattcggtggtg
acacatgatggaattggattcccttgttgggctcttccagatctcatgtcatttcctgat
aaattcggacttgatgcttataacaagcttgatgtgattggtattgatgaggctcagttc
tttggagatctttatgagttttgttgcaaagccgctgatgatgatggcaaaaccgtgatc
gttgcaggacttgacggtgactatttaaggaggagctttggtgctgtacttgatgttata
ccgatagctgattctgtaacaaagctaactgcaaggtgtgaggtttgtggacagaaagct
ttcttcactttgagaaagacttgtgataccagaaccgagcttattggtggagctgatgtc
tatatgcctgtttgtcgcaagcattacatcactaatcatattgttatgaaagcatccaag
aaagtgctggaagatgctgacaaggcaagagctgaatcctgtgttgctgttatcatctaa

DBGET integrated database retrieval system