KEGG   Camelina sativa (false flax): 104740855Help
Entry
104740855         CDS       T05044                                 

Definition
(RefSeq) methyl-CpG-binding domain protein 4-like protein isoform X1
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
csat  Camelina sativa (false flax)
Pathway
csat03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    104740855
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csat03036]
    104740855
   03400 DNA repair and recombination proteins [BR:csat03400]
    104740855
Enzymes [BR:csat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     104740855
Chromosome and associated proteins [BR:csat03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    104740855
DNA repair and recombination proteins [BR:csat03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     104740855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD
Motif
Other DBs
NCBI-GeneID: 104740855
NCBI-ProteinID: XP_010459910
LinkDB All DBs
Position
1
AA seq 452 aa AA seqDB search
MFPPVIYTYTRRRCRRLGRDDDSSVMMTRRRPDSATIEVRDENHSIGLFKEDDDDDIIRD
LGCIDESETRHGSSNLLSQCHRDDVCFLDKDNKSDSFVSCRRNLDDLFLGFAYKGVRSRK
RDDFGSETTSNLVSPRIADDDSVSESHLQVRRVSPYFQGSTVSQQSKVGCDSRSVCSQSR
RSCRKGCRKIQAKVPRVSPYFQASAISQCGSDIVSSQSVSRRESSKLQAKVRRVSRYFQA
SADSEQPRGLRRYFKVVKVSRYFHDVVPADGIEIDDSQKEKSRRVRKTPVVSPLLSLSQK
TDEAYLRKTPDKTWVPPRSPCNLLQEDHWHDPWRVLVICMLLNKTSGAQTRGVISDLFAL
CPDAKTAIEVEEKEIESLIKPLGLQKKRAKMIQRLSLEYLQENWTHVTQLHGVGKYAADA
YAIFCNGNWDRVKPNDHMLNYYWEFLRIRYKL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctccagtaatatatacgtatacgcgaaggagatgtcgaagacttggaagggac
gatgatagttcagtgatgatgactcgtcggagacccgactccgctactattgaggtaagg
gatgagaatcactcgattggtttatttaaggaggatgatgatgatgatataattcgagat
ttgggttgcattgatgagtctgaaactagacatggttcaagtaatttgctttctcaatgt
catcgtgatgatgtttgtttcctcgacaaggataataagagcgatagctttgtttcatgt
agaagaaatttggatgatttgtttcttgggttcgcttataagggtgtgaggagtaggaaa
agggatgactttggaagtgaaactactagtaatcttgtttctcctcgaattgctgatgat
gatagtgtttctgaatctcatcttcaagtaagaagagtttctccatacttccagggatct
actgtttcacaacagtccaaagtagggtgtgattctcgtagtgtttgctctcaaagtaga
agaagttgtaggaaaggatgcaggaaaattcaagctaaagttccaagagtttctccatac
ttccaggcatcagctatttcacaatgtggttctgacattgtttcatctcaaagtgtaagt
aggagagaaagtagcaaacttcaagctaaggttcgaagagtttcgcgttatttccaggcg
tcagctgattcagaacagccaagaggtttgcgtaggtattttaaggttgtgaaagtttca
agatatttccatgatgttgtgcctgcggatggaattgaaatcgatgattcacaaaaggag
aaatcaagaagggtgaggaaaactccggttgtgagccctttactctccctttctcaaaag
accgatgaggcatacctgcggaaaacgcctgataagacatgggtgcctccacgatctcca
tgtaatctacttcaagaagatcattggcatgatccatggcgggtgctggtcatatgtatg
cttctcaacaaaacatctggtgcacagacgcggggagtgatatcagacttgttcgcattg
tgtcctgatgcaaagactgcaatagaagttgaagaaaaagagatagagagtctgataaaa
cctcttggactacaaaagaagagagccaaaatgattcaacggttatctctcgagtatctt
caagagaactggactcacgtcactcaattgcatggcgttggaaagtatgcagcggatgcg
tatgcgatattctgtaacgggaattgggatcgcgtgaagcctaatgatcatatgctaaac
tattactgggaattcctcaggattcggtataaattatga

DBGET integrated database retrieval system