KEGG   Camelina sativa (false flax): 104741078Help
Entry
104741078         CDS       T05044                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00010  Glycolysis / Gluconeogenesis
csat00053  Ascorbate and aldarate metabolism
csat00071  Fatty acid degradation
csat00280  Valine, leucine and isoleucine degradation
csat00310  Lysine degradation
csat00330  Arginine and proline metabolism
csat00340  Histidine metabolism
csat00380  Tryptophan metabolism
csat00410  beta-Alanine metabolism
csat00561  Glycerolipid metabolism
csat00620  Pyruvate metabolism
csat00903  Limonene and pinene degradation
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104741078
   00053 Ascorbate and aldarate metabolism
    104741078
   00620 Pyruvate metabolism
    104741078
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104741078
   00561 Glycerolipid metabolism
    104741078
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104741078
   00310 Lysine degradation
    104741078
   00330 Arginine and proline metabolism
    104741078
   00340 Histidine metabolism
    104741078
   00380 Tryptophan metabolism
    104741078
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104741078
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    104741078
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104741078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 104741078
NCBI-ProteinID: XP_010460154
LinkDB All DBs
Position
14
AA seq 534 aa AA seqDB search
MASRKVSSLLARSFMSSSPSLLSLRGMNRGVQRYSNFAAALENTITPPVKVEHTQLLING
RFVDAASGKTFPTLDPRNGEVIAQVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRI
LFRFADLIEKHNDEIAALETWDNGKPFEQAAQIEVPMLARVFRYYAGWADKIHGMTVPAD
GPHHVQTLHEPIGVAGQIIPWNFPLLMLSWKLGPALACGNTIVLKTAEQTPLSALLVGRL
LHEAGLPEGVVNIVSGFGATAGAAIASHMDVDKVAFTGSTDVGKIILELASKSNLKAVTL
ELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAA
NRAVGDPFNSGIEQGPQVDSEQFKKILKYIKYGVEAGATLQTGGDRLGSKGYYIQPTVFS
DVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLASGVFTQNLDTANRLMRALR
VGTVWINCFDVLDATIPFGGYKMSGIGREKGLYSLSNYLQVKAVVTALKNPAWL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagaaaagtttcttcgttgctcgctcgctccttcatgtcctcctcgccttct
ctgttatctcttagaggtatgaacagaggagtacagagatacagtaatttcgctgctgct
cttgaaaacactattactccacctgtgaaagttgaacacactcagctcttaatcaatgga
agattcgttgatgcagcctctgggaaaacttttcctactctggatccaagaaatggtgaa
gtgattgctcaggtggctgaaggtgatgcagaagacgtgaaccgtgcggttgcagctgca
cgcaaggcttttgatgaaggaccatggcctagaatgacagcttatgagaggtcaaggata
ctgtttcggttcgctgacttgatcgagaaacataatgatgagatcgctgctcttgagact
tgggataatgggaaaccttttgaacaagctgctcagattgaagtgccaatgcttgctagg
gtgttccgatactatgctggttgggcagacaagattcatggaatgacagttccagcagat
ggtccacaccatgtgcagaccttgcatgagcctataggtgtcgctggacaaatcatccca
tggaacttccctcttctcatgctttcttggaaacttggaccagctttagcttgtggaaac
accattgttctcaagacggctgagcaaactcctttatctgctcttcttgttggaagacta
cttcatgaggctggacttcctgaaggagttgtgaatatagtttctggatttggtgctaca
gctggtgcagccatagctagtcacatggacgtagataaggttgctttcaccgggtctact
gacgtcgggaagatcattcttgagttggcttcaaaaagcaaccttaaggcagtgacactt
gagctaggaggaaagtcaccattcattgtatgtgaagatgctgatgtggatcaggccgtt
gagcttgcacatttcgctttgttctttaaccagggacaatgctgctgtgctggctcgcgt
acatttgtacatgaacgcgtgtacgatgagtttgtagagaaagctaaagctcgtgcagcc
aatcgcgctgttggagatcccttcaattcaggcattgagcaaggtcctcaggttgactca
gagcaattcaagaagatcctaaagtacattaaatatggagttgaggctggagccacatta
caaactggaggtgaccggcttggttccaagggttactacattcaaccaaccgtcttctca
gacgtgaaagatgacatgctcatagctacagacgagatattcgggccagttcaaaccata
ctgaagttcaaggatcttgatgaggtgattgcaagggcaaacaactcgaggtatggttta
gcttcaggagtgtttacacagaatctggacacagcaaaccgactgatgcgagccctcagg
gttggaaccgtttggattaactgttttgatgtacttgatgccacaattccatttggagga
tacaagatgagtggcattggaagagagaagggtctttacagtcttagcaactacttgcaa
gtcaaggctgttgtcactgcccttaagaatccggcctggctctaa

DBGET integrated database retrieval system