KEGG   Camelina sativa (false flax): 104751734Help
Entry
104751734         CDS       T05044                                 

Definition
(RefSeq) glutathione S-transferase U19-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104751734
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csat02000]
    104751734
Enzymes [BR:csat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104751734
Transporters [BR:csat02000]
 Other Transporters
  Pores ion channels [TC:1]
   104751734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_2 GST_N_3 GST_C GST_N_2 GST_C_5 GST_C_6 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-GeneID: 104751734
NCBI-ProteinID: XP_010472053
LinkDB All DBs
Position
16
AA seq 219 aa AA seqDB search
MANEVVLLDFWPSMFGMRTRIALREKGVEFEYREEDLRNKSPLLIQMNPIHKKIPVLIHN
GKPVVESSIQVQYIDEVWSHKNPILPSDPYHRAQARFWADFIDKKMYEAQRKVWATKGEE
QETGKKDFIEILKTLESELGDKPYFGGDDFGFVDIALIGFYTWFPAYEKFGNFSIEQECP
KLIAWVKKCLQRDSVAKSLPDPEKVTEFVSMLRSKFVPE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatgaggtggttcttcttgatttctggccgagtatgttcgggatgaggacgagg
atcgcactgagggagaaaggtgtcgaatttgagtacagagaagaagatctgaggaacaag
agcccgctgttgatccagatgaacccgatccacaagaagattccggttctcatccacaat
ggtaaaccggttgtcgaatccagcattcaggttcagtacattgatgaggtctggtctcac
aaaaaccctatccttccttctgatccttaccacagagctcaggctagattctgggctgat
ttcatcgacaaaaagatgtacgaggctcagaggaaggtgtgggcgaccaaaggtgaggaa
caagagacaggcaagaaggatttcattgagatactcaagacccttgagtctgagcttgga
gacaagccttactttggtggagatgactttggctttgtagacattgcattgattggtttc
tacacctggtttccagcatacgagaagtttggtaacttcagcatcgaacaagagtgtccg
aaactgattgcttgggtcaagaagtgtttgcagagggacagcgtggctaagtccttgcct
gatcctgagaaggttaccgaattcgtctccatgctcaggagcaaatttgtaccagagtag

DBGET integrated database retrieval system