KEGG   Camelina sativa (false flax): 104754994Help
Entry
104754994         CDS       T05044                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
csat  Camelina sativa (false flax)
Pathway
csat03030  DNA replication
csat03410  Base excision repair
csat03420  Nucleotide excision repair
csat03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104754994
   03410 Base excision repair
    104754994
   03420 Nucleotide excision repair
    104754994
   03430 Mismatch repair
    104754994
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csat03032]
    104754994
   03400 DNA repair and recombination proteins [BR:csat03400]
    104754994
Enzymes [BR:csat01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104754994
    6.5.1.6  DNA ligase (ATP or NAD+)
     104754994
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104754994
DNA replication proteins [BR:csat03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    104754994
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     104754994
DNA repair and recombination proteins [BR:csat03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104754994
   NER (nucleotide excision repair)
    Other NER factors
     104754994
   MMR (mismatch excision repair)
    Other MMR factors
     104754994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 104754994
NCBI-ProteinID: XP_010475605
LinkDB All DBs
Position
17
AA seq 792 aa AA seqDB search
MLAIRSSNCLRYVHCLATKTQFSSSVLLSFSRRVSHLRLSSCHRAMSSTRPSAFDALMSN
ARAAAKKKTPQTSSALSRSPNKRKIEETQDADLAKPLVSEGTVSKTEVPVEPVSDSAKPR
SDTSSIAEDSKTGAKKSRTLSKADKIGEMKSKIGLLKKKPNDFDPEKVSCWEKGERVPFL
FLALAFDLISNESGRIVITDILCNMLRTVIATTPEDLVATVYLSANEIAPAHEGIELGIG
EGSIIKAISEAFGRTEDQVKKQNTELGDLGLVAKGSRSTQTMMFKPEPLTVVKVFDTFRR
IAMESGKDSTEKKKNRMKALLVATTDCEPLYLTRLLQAKLRLGFSGQTVLAALGQAAVYN
EEHSKPPPNTKSPLEEAAKIVKQVFTVLPVYDIIVPALLTGGVWNLPKTCNFTLGVPIGP
MLAKPTKGVAEILNKFQDIVFTCEYKYDGERAQIHFMEDGTFEIYSRNAERNTGKYPDVA
IALSRLKKPSVKSFILDCEVVAFDREKKKILPFQILSTRARKNVNVNDIKVGVCIFAFDI
LYLNGQQLIQENLNIRREKLYESFEEEPGYFQFATALTSSDIDEIQKFLDASVDVGCEGL
IIKTLNSDATYEPAKRSNNWLKLKKDYMDSIGDSMDLVPIAAFHGRGKRTGVFGAFLLAC
YDVDKEEFQSICKIGTGFSDAMLDERSSSLRSQVITTPKQYYRVGDGLTPDVWFEPTEVW
EVKAADLTISPVHRAATGIVDPDKGISLRFPRLLRVREDKKPEEATSSEQVADMYQAQKH
NHPSNDVKGEDD
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgttagcaattcgatcatcaaattgcctccgatacgtacattgtctcgctacgaaaact
caattctcctcttccgtcttgctctcttttagccgcagagtttcccacttgcgccttagc
tcgtgccacagagccatgtcttctacccgtccttctgcatttgacgctcttatgtccaat
gctcgcgcagctgccaagaagaagactcctcagacttcctctgccttgtctcgctcgccg
aacaaaagaaaaattgaggaaacccaagacgctgatttggccaaacctcttgtttccgaa
ggtacagtatcgaaaactgaggttcccgtagagcctgtttctgattccgcgaaacccaga
tcggatacgtcgtcgattgcggaagattccaagaccggagcgaaaaagtctaggactttg
agcaaagctgataaaattggcgagatgaagagcaaaattggattgttgaagaagaagccc
aatgatttcgatcctgagaaagtgtcttgttgggagaaaggggagagagttccatttttg
tttcttgctttggcttttgatctgatttcaaatgaaagtggtcgaattgtgattactgat
attctgtgtaacatgttgagaaccgttattgccactacacccgaggatttggttgctact
gtttatctttctgcgaatgagattgctcctgctcatgaaggtatagaattgggaattggt
gagggttcaatcatcaaggcaatctctgaagcttttggtaggactgaggatcaggttaag
aagcagaatacggaactgggagacttggggcttgtagcaaaaggaagccgttcgactcag
actatgatgtttaagcctgaaccgttgactgttgtcaaggtttttgatacgtttcgacga
attgctatggaaagtggaaaagatagtacggaaaagaagaagaatcgaatgaaggcacta
cttgtggcaacaacagactgtgaacctctttacttaacacgtttacttcaggcaaaattg
cgtttagggttctcaggtcagactgttttagctgccttgggacaagccgctgtatataat
gaagagcactcaaagccaccgcctaataccaagtctcctttagaagaggctgcgaagatt
gttaaacaagtattcacggtgcttcctgtctatgacattattgttcctgcccttctaact
ggtggtgtgtggaatcttccaaaaacttgtaactttacactgggcgttccaattggaccc
atgcttgcaaaaccaaccaaaggtgtagcagagatactgaataaattccaggacatcgtt
ttcacatgtgaatacaaatatgatggagaacgtgcacagatacattttatggaggatggt
acatttgagatatacagtcgaaatgctgaaagaaacactgggaagtatccggatgttgcg
attgcgttatcaagattaaagaagccctctgtgaagtcttttattttggattgtgaggtt
gttgcttttgacagggagaaaaagaaaattcttccgttccagattttgagcactcgagcc
cgtaaaaacgtgaatgtcaatgatattaaggttggcgtatgcatctttgcttttgacata
ttatatctaaatggccaacaacttatccaagagaatcttaatattcgccgagagaagcta
tacgaatcatttgaggaagagccgggctatttccagtttgcaactgctctaacatctagc
gatatcgatgaaatccaaaagtttcttgacgcatctgttgatgttggctgtgaaggttta
attattaaaacattgaactcggatgctacctatgagcctgcaaagcgatcaaataattgg
ctaaaattgaagaaagactacatggacagcattggagactctatggatcttgtaccaatt
gctgctttccatggacgtggcaaacgcacaggtgtctttggtgcatttttactcgcttgt
tacgatgttgataaggaggagttccaaagcatttgtaaaatcggtactggattttctgat
gccatgcttgacgagaggtcgtccagtcttcgctctcaagtgataactactccaaaacaa
tactaccgagttggtgacggcctcactccagatgtttggtttgagcccactgaggtatgg
gaagtgaaagcagctgacttgacaattagccctgtgcaccgagcagctaccggcattgtg
gaccctgataagggaatttctcttcgttttcctcgtctactccgtgtacgggaagacaag
aagccagaggaagcaacatcatctgagcaggttgcagatatgtaccaagctcagaaacac
aatcatccaagcaatgatgtcaaaggtgaagatgattga

DBGET integrated database retrieval system