KEGG   Camelina sativa (false flax): 104758074Help
Entry
104758074         CDS       T05044                                 

Definition
(RefSeq) hexokinase-like 1 protein isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00010  Glycolysis / Gluconeogenesis
csat00051  Fructose and mannose metabolism
csat00052  Galactose metabolism
csat00500  Starch and sucrose metabolism
csat00520  Amino sugar and nucleotide sugar metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01200  Carbon metabolism
Module
csat_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csat_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104758074
   00051 Fructose and mannose metabolism
    104758074
   00052 Galactose metabolism
    104758074
   00500 Starch and sucrose metabolism
    104758074
   00520 Amino sugar and nucleotide sugar metabolism
    104758074
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104758074
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csat04131]
    104758074
Enzymes [BR:csat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104758074
Membrane trafficking [BR:csat04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104758074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 104758074
NCBI-ProteinID: XP_010479187
LinkDB All DBs
Position
17
AA seq 492 aa AA seqDB search
MSLMFASPVVTPTVGAFTFSSRRTNYIVMSAVRSNSTSLCPVLTKFQKDCATPTPYLREV
ANAIADDMRAGLAVEGGGDLDMILSYVDALPSGNEEGLFYALDLGGTNFRVRSVQLGGKK
ERVIATESEQISIPHKLMIGTSEELFGFIATKLASFVAKEKPGRFRLEQGKKRELGFTFS
FPVKQTSIDSGTLIKWTKGFNVSGMEGKNVVACLNEAMAVHGLDMRVSALVNDGVGTLAG
ARYWDEDVMVGVILGTGTNACYVEQKHVIPKLQSKSSSGTTIINTEWGGFSKILPRTIFD
REMDEKSLNPGEHLYEKMISGMYLGEIVRRVLLQMCEITDLFGQFLPVKLSTPFALRTEH
LCKIQEDKTDDLQMVGSVLYDILEVEASLEARRRVVEVCDTVIKRGGRLAGAGIVALLEK
IEKDTKRMGSGKRTVVAMDGALYEKYPQYREYMQDALVELLGHKLASYVAIKHTKDVSGL
GAALLAATNSIY
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtcactcatgttcgcttcccctgtcgtcactccaaccgtcggagctttcaccttctcg
tcccgccgcaccaactacatcgtgatgtccgccgtccgatctaactcgacttcactctgt
cctgtactgacaaagtttcagaaggactgcgccactcctacaccgtacctacgtgaagta
gccaacgccattgccgatgacatgcgagccggtctagctgttgaaggaggaggagatctc
gatatgatcttgagctatgttgacgctttgccttctgggaatgaggaagggctgttctat
gcattggatttaggaggtacaaattttcgggtgcgtagtgtgcaattaggaggaaaaaaa
gagcgtgtcatagctactgaatctgaacaaatatctattcctcataagcttatgattggt
acaagtgaggaactcttcgggttcattgctactaagttggcaagctttgttgcaaaggag
aagcccgggaggtttcggttggaacaagggaagaaaagggagttaggatttaccttttca
ttccctgtgaagcaaacctctattgattcaggcacactaatcaagtggactaaaggcttt
aatgtgtctggaatggaaggaaaaaatgtggttgcttgtttaaatgaagctatggcagtg
catggacttgatatgcgagtttctgccctcgtcaatgatggagtgggaacattagctgga
gcaaggtattgggacgaggatgtgatggtcggtgtgattcttgggactgggaccaatgct
tgttatgtagagcagaagcatgtcattcctaaactccaaagcaaatcttcttctggaaca
acgatcattaatacggagtggggagggttctctaagattcttccgcggactatttttgat
cgagagatggatgagaaaagcctgaatcctggtgaacatttatatgagaagatgatctca
gggatgtaccttggtgaaattgtaagaagggttttgcttcaaatgtgtgaaattactgac
ttgttcggacaattccttcctgtcaaactctccactccctttgcactcaggaccgagcat
ctatgcaaaatacaagaggacaaaactgatgatcttcaaatggttggatcagtcctatac
gacattctagaggtggaagcgagtctagaggcgaggaggagagtggtggaagtgtgtgac
acagtaataaaacgcggagggcgtctagcaggagctggtatagtagcactcctggagaag
attgaaaaagataccaaaaggatgggttcaggtaaaagaactgttgtggctatggacggt
gcactatacgagaagtacccgcagtatcgagagtacatgcaagatgcactagtcgagctt
cttggccataagcttgcaagttacgttgcgatcaaacataccaaagacgtgtctgggctc
ggtgcagctcttttggctgctactaactccatttactag

DBGET integrated database retrieval system