KEGG   Camelina sativa (false flax): 104758678Help
Entry
104758678         CDS       T05044                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00620  Pyruvate metabolism
csat00710  Carbon fixation in photosynthetic organisms
csat01100  Metabolic pathways
csat01200  Carbon metabolism
Module
csat_M00168  CAM (Crassulacean acid metabolism), dark
csat_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
csat_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
csat_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    104758678
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104758678
Enzymes [BR:csat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     104758678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 104758678
NCBI-ProteinID: XP_010479886
LinkDB All DBs
Position
17
AA seq 967 aa AA seqDB search
MANRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL
YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRVK
KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGIQERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAATMYFNQIEDLMFEMSMWRCNDELRVRADELHANARKDAAKHYIEFWKS
IPTTEPYRVILGDVRDKLYYTRERAHQLLSNGHSDVPEEATFINLEQFLEPLELCYRSLC
SCGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITTHLDIGSYREWSEE
RRQEWLLSELSGKRPLFGSDLPKTEEIADVLDTFHVIAELPADSFGAYIISMATAPSDVL
AVELLQRECHVKQPLRVVPLFEKLADLEAAPAAVARLFSVDWYKNRINGKQEVMIGYSDS
GKDAGRLSAAWQLYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
NGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPISPKPEWRVLLDEMAVVA
TEEYRSVVFKEPRFVEYFRLATPELEYGRMNIGSRPAKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGAAIKHVIEKDVKNLHMLQDMYQHWPFFRVTIDLIEMVFAKGDPGIAALY
DKLLVSEELWPFGEKLRANFEETKKLILQTAGHKDLLEGDPYLKQRLRLRDSYITTLNVC
QAYTLKRIRDPSYHVTLRPHISKEIAESSKPAQELIELNPTSEYAPGLEDTLILTMKGIA
AGLQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcggaagttggagaagatggcatcaattgatgttcatcttcgtcaacttgtt
cctggtaaagttagtgaagacgacaagcttgttgagtatgatgctttgctcttagatcgg
tttctcgatatcctccaggacttgcacggtgaagatctccgtgaaactgtgcaagagctt
tatgagcattctgcagaatatgaagggaagcatgaaccgaagaagctagaggagcttggg
aatgttctgacgagtttagatccaggggactctattgttatcgctaaagctttctctcac
atgcttaacttagccaatttggctgaggaagttcagattgcttatcgccgtagagtcaag
aagctgaagaaaggtgattttgttgatgagagctctgctactactgaatctgatctcgaa
gaaactttcaaaaagcttgttggtgatcttaataagtctcctgaagagatctttgatgct
ctcaagaatcagactgtggatttggttttgactgctcatcctactcagtctgtgagaaga
tcattgcttcagaaacatgggaggataagagactgtctggcccaactatatgctaaggat
attactcctgatgacaagcaagagcttgatgaggctctgcagagagagattcaagctgca
ttccgaacagatgaaatcaaaagaacaccacccactcctcaagatgagatgagagcagga
atgagttatttccatgaaactatctggaaaggtgttcctaagtttctgcgccgtgtagac
acggctttgaaaaacatagggatccaagaacgtgttccatataatgctccattgattcaa
ttctcttcctggatgggtggtgatcgtgatggtaacccaagggttacacctgaagtcact
agagatgtttgcttgttagctagaatgatggctgctactatgtactttaaccaaatcgaa
gatcttatgtttgagatgtctatgtggcgttgcaatgacgagctgcgtgtgcgagctgat
gaacttcacgcaaatgcgaggaaagatgctgcgaaacattacatagaattctggaagtca
attcctacaaccgagccataccgtgtgattcttggcgatgtaagggacaagctatattac
acacgtgaacgcgctcatcaattgctcagcaatggacactctgatgtccctgaagaggct
actttcattaacttggaacagttcttggaacctcttgagctctgttaccgatctctgtgt
tcatgtggtgaccgtccaatagcagatggaagccttcttgatttcttgaggcaagtctca
acctttgggctctctcttgtgagacttgacataaggcaagaatctgaccgccacaccgat
gtattggatgctatcaccacgcatttagatatcggatcctacagagaatggtctgaagaa
cgccgccaagaatggcttttatctgagctaagtggcaaacgtccgctattcggttctgat
cttcctaaaaccgaagaaatcgctgatgttctcgacacgttccatgtcatagccgagcta
ccagcagacagcttcggtgcttacattatctctatggcaactgcaccttctgatgtatta
gctgttgagcttttacagcgcgaatgccatgtgaaacagcctttaagagttgttccgctc
tttgagaagctggcggatcttgaagcagctcctgcagcagttgctaggctcttttctgtt
gactggtataagaaccgtattaacggtaagcaagaggttatgatcggttattcggattca
gggaaagacgctggacgtttgtccgctgcttggcagttatacaaagctcaagaagagctt
gtgaaggttgctaaagagtatggtgtgaagctaacaatgtttcacggtcgtggtggcacg
gttggaagaggaggtggaccgacccatcttgctatattgtctcagcctccggatactatt
aacggttcactccgtgtcacggttcaaggtgaagtcatcgagcaatcgtttggtgaagag
catttatgctttagaacgcttcagcgtttcaccgctgctacactagagcacggtatgcgt
cctcctatttcgcctaaaccggaatggcgcgtgttgctcgatgaaatggcggttgttgca
accgaggagtatcgttctgttgtgtttaaagaacctcggtttgtcgagtacttccgcctt
gctacaccagaactggagtatggtcgtatgaacattggaagcagacctgcgaagcggaaa
ccaagcggtggcattgaatctcttcgtgcgattccgtggatctttgcttggactcaaaca
agattccatcttcctgtatggcttggattcggagcagcgattaaacacgtgatcgaaaag
gacgtcaagaacctccatatgctccaagatatgtaccaacactggcctttctttagagtc
accattgatctaattgaaatggtgttcgccaaaggagatcctggtattgctgctttgtac
gacaagcttcttgtttcagaagaactctggccttttggtgagaaactcagagctaatttc
gaagaaaccaagaaactcatcctgcagaccgctggacacaaagatcttcttgaaggagat
ccttacttgaaacaaagactgagacttcgtgattcttacatcacaactctcaatgtctgt
caagcttacacattgaaaagaatccgtgatccgagttaccatgtgacactgcgacctcac
atctctaaggagattgcagaatcaagcaaaccagcacaagaactcatcgagcttaacccg
acaagtgaatacgcgcctggacttgaagatacactcatcttgacaatgaagggtattgct
gctggtctacagaacaccggttaa

DBGET integrated database retrieval system