KEGG   Camelina sativa (false flax): 104761203Help
Entry
104761203         CDS       T05044                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00040  Pentose and glucuronate interconversions
csat00051  Fructose and mannose metabolism
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    104761203
   00051 Fructose and mannose metabolism
    104761203
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     104761203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PALP UDPG_MGDP_dh_N Methyltransf_25 Pyr_redox_2 TrkA_N AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 104761203
NCBI-ProteinID: XP_010482545
LinkDB All DBs
Position
18
AA seq 364 aa AA seqDB search
MGKGGMSHGEGSKVGEENMAAWLVGINTLKIQPFPLPSVGPHDVRVRMKAVGICGSDVHY
LKTMRCADFVVKEPMVMGHECAGIIEEVGEEVKHLVVGDRVALEPGISCWRCNLCREGRY
NLCPEMKFFATPPVHGSLANQVVHPAELCFKLPENVSLEEGAMCEPLSVGVHACRRAEVG
PETNVLVMGAGPIGLVTMLAARAFGVPRIVIVDVDENRLSVAKQLGADGIVQVTTSLEDV
GSEVEQIQKAMGSNIDVTFDCAGFNKTMSTALAATRCGGKVCLVGMGHGIMTVPLTPAAA
REVDVVGVFRYKNTWPLCLEFLTSGKIDVKPLITHRFGFSQKEVEDAFETSARGSNAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggagggatgtctcacggagaaggctcaaaggttggagaagagaacatggct
gcttggttggttggtatcaatacccttaagatccaaccttttcctcttccttctgttggt
cctcatgatgtgagagttaggatgaaagctgttggtatttgtggaagtgatgttcattac
cttaagaccatgagatgtgcggattttgtggtgaaagaaccgatggtgatgggacatgaa
tgtgctgggatcattgaagaagtaggtgaagaagtgaaacatctagtggttggtgaccgt
gttgctcttgaacctgggatcagttgttggagatgcaatctctgcagggaaggaagatac
aacctttgtccagagatgaagttctttgcaaccccaccagttcatggctctctagctaac
caagtagttcaccctgcggagctatgcttcaaattgcctgagaatgtgagtttggaggaa
ggagcaatgtgtgaaccactaagtgttggtgtgcatgcatgtcgtcgagctgaggtcggc
cctgaaacaaatgtcttggtaatgggagctggacctattggccttgtcaccatgttggcc
gctcgggctttcggtgtgcctagaattgttattgtggatgttgatgagaaccgtttatct
gtagccaaacagctcggtgcagatgggattgttcaagtgacaacaagcttagaggatgtt
ggttctgaggttgaacaaatccagaaagctatggggtcaaacattgatgtgacattcgat
tgtgcgggttttaacaaaaccatgtcgacagcattagcagccactcggtgtggtggtaaa
gtctgtcttgttggaatgggtcatggtataatgactgtccctctcactcctgcagctgca
agggaggtagatgtggtaggtgtattcaggtacaagaacacatggcctttgtgtcttgag
ttcctgacaagtggtaagattgatgtaaagccactcataacccacagattcggtttctct
cagaaggaagtggaagacgcctttgaaaccagtgctcgtgggagcaatgccatcaaagtt
atgttcaatctctga

DBGET integrated database retrieval system