KEGG   Camelina sativa (false flax): 104761835Help
Entry
104761835         CDS       T05044                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00564  Glycerophospholipid metabolism
csat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104761835
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     104761835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 GIDA HI0933_like Pyr_redox AAA_30 3HCDH_N Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 104761835
NCBI-ProteinID: XP_010483312
LinkDB All DBs
Position
1
AA seq 630 aa AA seqDB search
MSVASIRRLAAGAAVFAAAATGGAVYLSPSVVSSDRGGGPVLDSLRRMIGDPAATVPSRS
AQESALIAASASNPLDVLVIGGGATGSGVALDAATRGLRVGLVEREDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLKLVFHALEERKQLIDNAPHLCHALPCMTPCFDWFEVIYFWM
GLKMYDLVAGPRLLHLSRYYSAQESIELFPTLARKGKDKNLRGTVVYYDGQMNDSRLNVG
LACTAALAGAAVLNHAEVVSLITDDATKRIIGARVRNNLTGQEFDSYAKVVVNAAGPFCD
SIRKMVDEDTKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTT
DSNTSITALPEPHEDEIQFILDAISDYLNIKVRRTDVLSAWSGIRPLAMDPTAKSTESIS
RDHVVFEESPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLSPTNECVTQKLQLLGSYGWE
PSSFTTLAQQYVRMKKTYGGKVVPGAMDTAAAKHLSHAYGSMADRVATIAQEEGLGKRLA
HGHPFLEAEVAYCARHEYCESAVDFIARRCRIAFLDTDAAARALQRVVEILASEHKWDKS
RQKQELQKAKEFLETFKSSKNAQFNDGKHN
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcgcttctatccgccgtttagccgccggagcagccgtatttgctgctgctgct
accggtggcgctgtctacctgtctccgtcggttgtctccagcgacagaggcggtggtcct
gttctagattcgttgcggcgtatgattggtgatcccgccgctaccgtaccgtctcgatct
gctcaagagtctgctctgattgcagccagcgcttctaatccgctcgatgttctcgtcatt
ggcggtggagccaccggttctggagtcgctctcgacgctgctacacgtggtctccgtgtt
ggtcttgtagagcgagaggatttctcctccggtacttcttcccgatcaactaagctgatt
catggaggggttcgttacttggagaaagctgttttcaatcttgattatggacagctgaag
cttgtatttcacgcacttgaagagcgtaagcagctcattgataatgcaccacatctctgc
catgctctgccctgtatgactccttgttttgactggttcgaagttatctacttctggatg
ggattgaaaatgtatgacttggtcgctggaccacgcttattgcatctatccagatattac
tctgcacaagagtctattgagctcttccccactcttgcaaggaaagggaaagacaagaat
ttaaggggaactgttgtttattatgatgggcaaatgaatgattcacgtctgaatgtgggt
ttggcatgtactgccgctttagctggtgcagctgttctcaaccatgccgaggttgtctcg
cttattacagatgatgctactaagagaataattggtgcccgagtccgtaacaatctcaca
ggccaagaatttgacagctatgcaaaagtagttgttaatgcggctggaccgttctgtgat
tccattaggaagatggttgatgaagatacaaaaccaatgatatgcccaagcagcggtgta
cacattgtgctgcctgattactattctccagaagggatgggcttgatagtccctaaaact
aaggatggtcgtgttgtatttatgttaccgtggttgggaagaacagtagcaggtaccact
gactctaacacgtcaatcactgcacttccagaacctcatgaagatgagattcaatttata
ctggatgcaatcagcgactatcttaacatcaaggttcgacgtactgatgttctttcggct
tggagtggtatccgtccattggccatggatccaacagccaagagcacagagagcatctcc
agagaccatgttgtctttgaggaatctcctggtctggttacaatcacgggtggaaaatgg
acaacttaccgaagcatggcggaagatgcagttgatgcagcaatcaaatcgggaaagcta
agtccaaccaatgaatgtgtaacgcagaaactacagcttctgggttcttatggatgggaa
ccatcttccttcacaactcttgcacagcaatacgtgcgaatgaagaaaacctacggtggt
aaagtggttcctggagcaatggacacagctgctgcaaagcatttgtctcatgcctatggt
tcaatggctgaccgagtcgccaccatagctcaggaggagggtttggggaaacggttggcg
cacggtcatccgtttttggaagcagaggttgcttactgtgcaaggcacgagtactgcgaa
tcagcggttgatttcatagcaaggagatgtagaatcgcgttcttggacacagacgcagct
gcgcgggcgttgcagcgtgtggtggagattctagcaagtgaacacaagtgggacaagtcg
aggcagaagcaggaattgcaaaaggctaaagagtttcttgaaactttcaagtcttccaaa
aacgcacagtttaacgatggcaaacacaactaa

DBGET integrated database retrieval system