KEGG   Camelina sativa (false flax): 104763686Help
Entry
104763686         CDS       T05044                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00020  Citrate cycle (TCA cycle)
csat00190  Oxidative phosphorylation
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104763686
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104763686
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104763686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 104763686
NCBI-ProteinID: XP_019095823
LinkDB All DBs
Position
18
AA seq 505 aa AA seqDB search
MCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALL
HTLYGQAMKHNTQFFVEYFALDLLMASDGSCQGVIALNMEDGTLHRFRSAQTILATGGYG
RAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRN
SEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPHKDHIYLHLNHLPPEVLKERL
PGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVIPGLMAAG
EAACASVHGANRLGANSLLDIVVFGRACANRVAEISKPGEKQKPLEKDAGEKTIAWLDRL
RNSNGSLPTSTIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFGDVQVKDRSLIWN
SDLIETLELENLLINASITMHSAEARKESRGAHAREDFTKREDGEWMKHTLGYWEDEKVR
LDYRPVHMDTLDDEIDTFPPKARVY
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagagaggcaccaaaagcagttattgaacttgagaattatggtctgccgttttct
cgtactgaagaggggaaaatttaccagcgtgcatttggtggtcagagtcttgattttgga
aaaggtggtcaggcctatcgttgtgcttgtgctgcggatcggactgggcatgctctgttg
catactctctatggacaagccatgaagcataacacccagttctttgttgaatactttgcc
ttggatttgctcatggctagtgatggcagttgccagggtgtaattgcactaaacatggaa
gatggaacattgcatcgtttccgctctgcacaaacaattttggccactggggggtacggc
agagcatacttctctgcaacctcagcacatacttgcacaggtgatggaaatgccatggtt
gcacgggccggtcttccactccaggacttggagtttgttcaattccatccaactggtata
tatggggccggatgtctcatcactgaaggatctcgaggtgaaggtggtatcctgagaaac
agtgaaggtgaacgttttatggaacgatatgctcctacagccaaggatcttgcatcaaga
gatgttgtctccagatccatgactatggaaatcagggaaggtcgtggtgtaggaccgcat
aaggatcatatctatctgcatttgaatcatcttcctccagaagttctaaaagaaaggctt
cctggaatctctgagaccgctgccatctttgctggtgttgatgttaccaaagagccaatt
ccagtcttacccacggttcattataacatgggtggtatcccgacaaactaccacggcgag
gtagttaccatcaaaggtgatgatcctgatgcagtgattcctgggctaatggctgctgga
gaggcagcttgtgcatctgttcatggcgccaacaggcttggtgcaaattcactgctcgac
atcgtcgtgtttggtcgtgcctgtgcaaatagagttgcagagataagcaagccaggggag
aaacagaaacctcttgagaaggacgcgggtgagaagactattgcatggctggacaggttg
agaaactcaaacggttcgcttcctacttcaactattagattgaacatgcagagagttatg
cagaacaacgcagctgtcttccgcacacaagaaacattggaagaaggttgtcagttgatt
gacaaggcgtgggaaagttttggggacgtccaggtgaaagatcggagtttgatatggaac
tctgatttgatagagacattggaactggagaaccttttgataaacgcatccataacaatg
cattcagcggaagcaagaaaggaaagcagaggagcacatgcccgggaagatttcacgaaa
agagaggatggagaatggatgaagcatacgttgggatattgggaagatgagaaagtgaga
ttggattatagacctgttcacatggacactctcgacgatgaaattgacactttccctcct
aaagctcgtgtctattga

DBGET integrated database retrieval system