KEGG   Camelina sativa (false flax): 104764520Help
Entry
104764520         CDS       T05044                                 

Definition
(RefSeq) methyl-CpG-binding domain protein 4-like protein
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
csat  Camelina sativa (false flax)
Pathway
csat03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    104764520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csat03036]
    104764520
   03400 DNA repair and recombination proteins [BR:csat03400]
    104764520
Enzymes [BR:csat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     104764520
Chromosome and associated proteins [BR:csat03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    104764520
DNA repair and recombination proteins [BR:csat03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     104764520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD Exo70
Motif
Other DBs
NCBI-GeneID: 104764520
NCBI-ProteinID: XP_019096295
LinkDB All DBs
Position
19
AA seq 428 aa AA seqDB search
MMTRRRPDSATIEVRDENHSIGLFKEEDDDIIRDLGCIDESETRHGSSNLPFQCHRDDVC
CLDKDNKSDSFVPCRRNLDDLFLGFAYKGVRSMKRDDFESETTSDLVSPQMVDDDTVSES
HLQVRRVSPYFQGSTVSQQSKVGCDSRSVCSQSRRSCRKGCRKVQAKVPRVSPYFQASGI
SQCDSDIVSSQSGSRRESSKLQAKVRRVSRYFQASADLEQPRDLRKYFKVVKVSRYFHDV
VPADGNGIQVNESKNEKSRRVRKTPVVSPLLSLSQKTDEAYLRKTLDNTWVPPPSPCNLL
QEDHWHDPWRVLVICMLLNKTSGAQTRGVISDLFALCPDAKAATKVEEKEIESLIKPLGL
QKKRAKMIQRLSLEYLQESWTHVTQLHGVGKYAADAYAIFCNGNWDRVKPNDHMLNYYWE
FLRIRYKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgatgactcgtcggagacccgactccgctactattgaggtaagggatgagaatcactcg
attggtttatttaaggaggaggatgatgatatcattcgagatttgggttgcattgatgag
tctgaaactagacatggttcaagtaatttgccttttcaatgtcatcgtgatgatgtttgt
tgcctcgacaaggataataagagcgatagctttgtcccatgtagaagaaatttggatgat
ttgtttcttgggttcgcttataagggtgtgaggagtatgaaaagggatgactttgaaagt
gaaactactagtgatcttgtttctcctcaaatggttgatgatgacactgtttctgaatct
catcttcaagtaagaagagtttctccatacttccagggatctactgtttcacaacagtcc
aaagtagggtgtgattctcgtagtgtttgctctcaaagtagaagaagttgtaggaaagga
tgcaggaaagttcaagctaaagttccaagagtttctccatactttcaggcatcaggtatt
tcacaatgtgattctgacattgtttcatctcaaagtggaagtaggagagaaagcagcaaa
cttcaagctaaggttcgaagagtttcgcgttatttccaggcgtcagctgatttagaacag
ccaagagatttgcgtaagtattttaaggttgtgaaagtttcaagatatttccatgatgtt
gtgcctgcggatggaaatggaattcaagtcaatgaatcaaaaaatgagaaatcaagaagg
gtgaggaaaactccggttgtgagtcctttactctcgctttctcagaagaccgatgaggca
taccttcggaaaacgctggataacacatgggtgcctccaccatctccatgtaatctactt
caagaagatcattggcatgatccatggcgggtgctagttatatgtatgcttctcaacaag
acatctggtgctcagacgcggggagtgatatcagacttgttcgctttatgtcctgatgca
aaggctgcaacaaaagttgaagaaaaggagatagagagtctgataaaacctcttggatta
caaaagaagagagccaaaatgattcaacggttatctctggagtatcttcaagagagctgg
actcatgtcactcaattgcatggcgttggaaagtatgcagcggatgcgtatgcgatattc
tgtaacgggaattgggatcgggtgaagcctaatgaccatatgctaaactattactgggaa
ttcctcaggattcggtataaattatga

DBGET integrated database retrieval system