KEGG   Camelina sativa (false flax): 104767097Help
Entry
104767097         CDS       T05044                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHR1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00310  Lysine degradation
csat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104767097
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csat03036]
    104767097
Enzymes [BR:csat01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     104767097
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     104767097
Chromosome and associated proteins [BR:csat03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104767097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND TPR_12
Motif
Other DBs
NCBI-GeneID: 104767097
NCBI-ProteinID: XP_010489431
LinkDB All DBs
Position
19
AA seq 498 aa AA seqDB search
MEEASLMADLERFLEDRCLSVLNLPQKGRSLFATRGFRPGEVILSQKPYICVPNNNNNNT
SSSSESRCDGCFKTNDNNLKRCSGCQVVWYCGSSCQKSEWKLHRHECKALSTLDKEKRKF
VTPTIRLMVKLYIKRNLQNEKVLPVTTTDNYSLVEALVSHMSEIDEKQMLLYAQMANLVN
LILQLPSVDLREIAENFSKFSCNAHTICDSELRPQGIGLFPFVSIINHSCSPNAILVFEE
QMAVVRAIDKIPKDSEITISYIETAGSTLTRQKSLKEQYLFHCQCARCNNFGKPHDIEES
AILEGYRCADEKCTGFLLRDPEEKGFVCQKCLLLRSKEEVKKLASEVKRVSENAPASPSA
ENKQGAIELYKTIEKLQVTLYNSFSITLMRTREKLLKMLMDVESWREALNYCRLIVPVYQ
RVYPATHPLIGLQFYTQGKLEWLLGETKEAVSSLTKAFDVLRISHGTSTPFMKELSAKLE
EARAEASYIDRQTYNDDN
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagcttcactaatggcggatttggagaggtttctggaagatcgctgcttaagc
gttttgaatcttccacagaaaggccgctctcttttcgctaccagaggttttcgtccaggc
gaagtgattctaagccaaaagccatatatttgtgttccgaataataataataataataca
tcgtcctcctcggaatcaagatgtgatggatgtttcaagaccaatgataataaccttaag
agatgttctggttgtcaagttgtttggtactgtgggagctcttgccagaagtcagagtgg
aagttgcatcgccatgaatgcaaagctctctctacgcttgacaaagagaaacggaagttt
gttactcctacgatacgtctgatggtcaaactttacatcaagaggaatttgcaaaatgaa
aaggtcctgccagttacaacaactgacaattatagtttggtggaggctttggtgtcccac
atgtctgagattgatgaaaagcagatgttgttgtatgcacagatggctaatcttgtgaac
ttgattcttcaattacctagtgttgacctaagagagatcgccgagaacttttcaaagttt
tcatgcaatgctcataccatttgtgatagcgaattgagacctcaagggataggattgttt
ccctttgtctccatcataaatcacagctgctctcccaatgcgattttagtgtttgaggag
cagatggctgttgtccgggcgatagataagataccaaaggattcagagataactatcagc
tatattgaaaccgctggaagcactctgactcggcagaagtctttaaaagaacaatacctc
ttccactgtcagtgtgctcgttgcaataactttggaaaacctcatgatattgaagaaagt
gcaatattggaaggttatcggtgtgccgatgagaaatgcactggtttcttactccgtgat
cctgaagaaaaaggctttgtttgccagaaatgcttgcttcttaggagcaaggaagaggtt
aaaaagttagcaagtgaggtcaaaagagtttcagagaatgctcctgcatctccttctgca
gaaaataaacaaggcgctattgaactatataagacaattgagaaactacaagtgacgctt
tacaattctttctccattactttaatgagaacccgtgaaaaacttctcaagatgctaatg
gatgtagaaagctggagagaagctttgaattactgcaggctaatagtccctgtttaccaa
agagtatatccagcaacccatcctttgattggactgcagttctatacccagggaaaactc
gaatggttgctgggggaaaccaaagaggcggtgagttcactgactaaggcatttgacgtt
ctgcggatcagccacggaacaagcacacctttcatgaaagagctctcagcaaagttggag
gaggctcgtgcagaagcttcttatattgatagacagacttataatgatgacaactag

DBGET integrated database retrieval system