KEGG   Camelina sativa (false flax): 104773439Help
Entry
104773439         CDS       T05044                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 6-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
csat  Camelina sativa (false flax)
Pathway
csat03030  DNA replication
csat03410  Base excision repair
csat03420  Nucleotide excision repair
csat03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:csat00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104773439
   03410 Base excision repair
    104773439
   03420 Nucleotide excision repair
    104773439
   03430 Mismatch repair
    104773439
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csat03032]
    104773439
   03400 DNA repair and recombination proteins [BR:csat03400]
    104773439
Enzymes [BR:csat01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104773439
    6.5.1.6  DNA ligase (ATP or NAD+)
     104773439
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104773439
DNA replication proteins [BR:csat03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104773439
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104773439
DNA repair and recombination proteins [BR:csat03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104773439
   NER (nucleotide excision repair)
    Other NER factors
     104773439
   MMR (mismatch excision repair)
    Other MMR factors
     104773439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 104773439
NCBI-ProteinID: XP_019098207
LinkDB All DBs
Position
Unknown
AA seq 1395 aa AA seqDB search
MVSDSGVTTIAGNSETLNIDSTNLYSSAISSISPQFPPPKPPFSSLSIPQSKRIPKTNFI
VDLFRFPQHSSSSSSSSFAFFLSHFHSDHYSGLSSSWSRGIIFCSHKTARLVEQVLQVPS
QFVFALPMQQIVVIDGSEVVLIDANHCPGAVQFLFKVTLEDGGFERYVHTGDFRFCDEMR
FDSSLSGFVGCDGVFXDTTYCNPKFVFPTQEESVGYVVSVVDKISEECVDTKKKVLFLVA
TYIVGKEKILVEIARRCKRKIVVDARKISILSVLGCGEDGMFTEDENESDVHVVGWNVLG
ETWPYFRPNFLKMNEIMVEKGYDKVVGFVPTGWTYEVKRNKFAVRFKDSMEIHLVPYSEH
SNYDELREYIKFLKPKRVIPTVGVDIEKLDSKEVNKMQKHFSGLVDEMANKKDFLLGFYR
QSYQKNEKNDIDVYEGEEKKVCEDGGDNVSSSTGPLLHDTAPSSVTERLLVEVRDSLPAW
VTEEQMLDLIKKHAGDPVEIVSNFYECEAELYKQSSLPTPSFENQVVSFDDDVTDLQPNP
VKSTCPDVRAIQKGFDSPRKMNLTKGTISPGKRSKSSGSSKSNKKAKKDPKSKPVGPRQP
TIFKFFNKVLGSGSNSVGVCSEAEGCNTDKKMVHNDATQIYKEVTDQFIDIVNGYECLRD
YVASIIDEAKGDINRALDIYYSKPSEIPGEHAGEGGLSSKTIQFPEFPQACSSQENKKAP
EKSGYEVNICVQTSAEEIVDKNYVSLPSEKYKPKEHACWREGQPAPYIHLVRTFASVEGE
KGKIKAMSMLCNMFRSLLALSPEDVLPAVYLCTNKIAADHENIELNIGGSLISSALEEAC
GISRSTVRDMYNRLGDLGDVAQLCRQTQKLLVPPPPLLVRDVFSTLLKISLQTGTGSTRQ
KKNLIVKLMRSCREKEIKFLVRTLARNLRIGAMLRTVLPALGQAIVMNSFWNCHNKEPSE
SSFREKLEGVSAAVVEAYNILPSLDVVVPSLMEKDIEFSTSTLSMVPGIPIKPMLAKIAK
GVQDFYNLFQDKAFTCEYKYDGQRAQIHKLLDGTVRIFSRNGDETTSRFPDLVDVIKRFS
CHVAETFMLDAEVVATDRLNGNKLMSFQELSTRERGSKDALITTESIKVEVCVFVFDIMF
VNGEQMLALPLRERRRRLKEVFPETRPGYLEYAKEITVGAEEASLNNQDTLSRINAFLEE
AFHSSCEGIMVKSLDVDAGYYPTKRSDSWLKVKRDYVDGLGDTLDLVPIGAWHGNGRKAG
WYSPFLMACFNPETEEFQSVCRVMSGFSDAFYIEMKEFYSGEKILAKKPPYYRTGETPDM
WFSAEVVWEIRGADFTVSPVHSAALGLVHPSRGISVRFPRFLRKVTDRNPEECSTATDIA
EMFHAQTRKMNIVSQ
NT seq 4188 nt NT seq  +upstreamnt  +downstreamnt
atggtctccgattccggcgtaaccacaatcgccggcaactcagaaaccctaaacatcgac
tctacaaatctctactcatcagcaatctcctctatctctccccaattccccccaccgaaa
ccacccttctcatctctttcaatccctcaatcaaaacgaatccccaaaactaattttatc
gtggacctcttccgcttcccacaacactcctcctcctcctcatcctcctccttcgccttc
ttcctctcgcatttccactccgatcattactccggcctctcgtcttcttggtccagagga
attatcttctgctcacacaaaaccgctcgtctcgttgaacaagtccttcaagttccgtca
cagttcgtcttcgctttgcctatgcaacaaatcgttgtgatcgatggctctgaagttgtt
ttgattgacgcgaatcactgtcctggagcggtacagttcttgtttaaagtcacattggag
gatggtggatttgagaggtatgttcatactggagattttcgattctgtgatgagatgaga
tttgattcgtctctaagtggctttgttggatgtgatggtgtgttcntggatactacttat
tgtaatcctaagtttgttttcccgactcaagaggaatctgttggttatgtggttagtgtg
gtagataagattagtgaggagtgtgtggatacgaagaagaaggttttgtttcttgttgct
acttatattgttggtaaagagaagattttggttgagatagctaggagatgtaagaggaaa
atcgttgtggatgcgaggaagatctcgattttgtcggttttggggtgtggagaggatgga
atgtttacagaggatgagaatgagagcgatgttcatgttgtgggatggaatgtgttgggt
gagacttggccgtattttaggccgaattttttgaaaatgaatgagattatggttgagaaa
gggtatgataaagttgtaggttttgtgcctacagggtggacttatgaagtgaagcggaat
aagtttgcggttaggtttaaagattcaatggagattcatcttgtaccgtatagtgagcat
tcgaattatgatgaacttagagagtacattaagttcttgaaacctaaaagagttattcct
actgttggagttgatatcgagaagcttgatagcaaggaggttaataagatgcagaaacat
ttttcaggattggtagatgaaatggcaaacaagaaggattttttattgggtttctatcgc
caatcttaccagaagaatgagaaaaatgacatagatgtttacgaaggggaagagaaaaaa
gtatgtgaagacggtggagataatgtttcatcatctacaggacccttattgcatgataca
gctcctagttctgtgacggaaagattgttggtagaagtacgtgattctttgcctgcttgg
gttactgaagagcagatgttagatctgattaagaagcatgctggtgatcctgtggaaatc
gtaagtaacttttatgaatgtgaagcagagctttacaagcaatcctctctccccacgcct
tccttcgaaaatcaggttgtttcgtttgatgacgatgtaaccgacttgcaaccaaatcct
gtgaagagcacttgtccagatgttcgagcaattcaaaaaggttttgactcaccaagaaaa
atgaatttaacaaagggtaccatttctcctgggaaaagaagcaaaagctcgggcagtagt
aagtctaacaagaaggccaagaaagatccaaaatcgaaaccagttggtccgaggcagcca
accatttttaagttcttcaataaggtcttgggtagtggatctaattctgttggtgtttgt
tcagaggctgaaggatgcaatactgataaaaagatggtccacaatgatgcgacacaaata
tacaaagaagtgacagatcaatttattgatattgtcaatggttatgaatgtttaagagat
tatgttgcgtccatcattgatgaggctaaaggagatataaatcgggcattggacatctat
tacagcaaacccagtgaaatacctggtgagcatgcaggtgagggaggactctctagcaaa
acgatccagtttccggaatttccacaagcatgctcctctcaggagaacaaaaaggcacca
gaaaaatcaggatatgaagttaacatatgtgtgcagacatcagcagaagaaattgtggac
aaaaattatgtatctctaccttcggaaaagtataaacctaaagagcacgcttgttggagg
gagggacaaccagctccatatatacaccttgtccgaacatttgcttccgttgaaggtgaa
aagggcaagatcaaagctatgtctatgctttgcaacatgtttagaagtttgttggctctc
tctccagaagatgttctgcccgctgtttatctttgcacaaataagattgccgctgaccat
gagaatattgagcttaacattggtggaagcctaatctcttctgcattggaagaagcatgt
ggaataagtcgatctactgtgagagatatgtataataggctgggggatcttggagatgtt
gctcagctatgtcgacaaacgcaaaagctactggttcctccacctccacttctagttaga
gatgtgttttcaactttactaaagataagtttgcaaacaggtactggaagtactaggcaa
aagaaaaatctcatcgtgaagctaatgcgctcttgtagagaaaaagagatcaaatttctt
gttagaacgttggcccgtaatttaaggattggcgctatgttgagaactgttttgcctgca
ctcgggcaagcaatcgttatgaattctttctggaattgccataacaaagaaccatcagaa
agcagtttcagagagaaacttgagggtgtttctgctgcagtagttgaggcttacaacatt
cttccttctctggacgtggttgttccttctctcatggaaaaagacattgagttttcaacg
tcaactttgtcaatggtcccagggatacctataaaacccatgcttgcaaaaattgctaag
ggggttcaagatttttataacctcttccaagacaaggcttttacttgtgaatacaaatat
gatggccagcgcgcccagatccataagttacttgatggtactgtgcgtatcttttctcgg
aatggggacgaaacaacatccagatttccggatctggttgatgtcataaaacggttttct
tgccatgtcgctgagacattcatgttggacgcagaggtggttgccactgatagattgaat
ggaaacaaactcatgtcattccaagagttatcaacaagagagagagggagcaaagatgct
ttgataactacagaaagtattaaggttgaagtatgcgtcttcgtgtttgatattatgttc
gtcaatggagaacagatgttggctcttcccctccgtgagagacgaaggcgtctaaaggag
gtcttccctgagactagaccaggttatcttgaatatgctaaggaaataactgtgggagca
gaagaagcgtctttgaataatcaagacactttgagtaggataaatgcttttctcgaagaa
gcatttcattcatcttgtgaaggaatcatggtcaagtctttagatgttgatgctggatac
taccctacaaagcgctctgattcatggctcaaggttaagcgagattatgtggatggattg
ggcgacacattggatttagttcctataggtgcttggcatggcaacgggagaaaagcagga
tggtatagtccattccttatggcctgcttcaaccctgagactgaggaattccaaagtgta
tgtcgtgtcatgtctggtttttctgatgccttttacatcgagatgaaagaattctactcc
ggggaaaagatccttgcgaaaaagccgccttactacagaacaggggagacacctgacatg
tggttttccgcagaggttgtttgggaaatcagaggtgcagatttcacggtctcgcctgtt
cacagtgccgctttaggtctagtccatccatctcgagggatttctgttaggtttccgaga
tttcttcgtaaagtgacagatagaaatcctgaggaatgcagcacggctacagatatcgcg
gagatgtttcatgctcaaaccagaaaaatgaacatcgtctctcaatag

DBGET integrated database retrieval system